spacer

EBI Dbfetch

ID   BC029065; SV 1; linear; mRNA; STD; MUS; 2102 BP.
XX
AC   BC029065;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus cysteine-rich with EGF-like domains 1, mRNA (cDNA clone
DE   MGC:36321 IMAGE:4935296), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2102
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2102
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 808d7459b6c073230a1de6d123f5337a.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 60 Row: a Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19527147.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2102
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:36321 IMAGE:4935296"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2102
FT                   /gene="Creld1"
FT   misc_difference 1..24
FT                   /gene="Creld1"
FT                   /note="24 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             371..1633
FT                   /codon_start=1
FT                   /gene="Creld1"
FT                   /product="cysteine-rich with EGF-like domains 1"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="AAH29065.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   misc_difference 2076..2102
FT                   /gene="Creld1"
FT                   /note="polyA tail: 27 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2102 BP; 432 A; 589 C; 620 G; 461 T; 0 other;
     cggacgcgtg ggcggacgcg tgggcgcctt tctctcggaa tattttggga tccaaccctc        60
     tctctaattt tggcccctaa taactcactg agaccctaaa acaatgggct gacgcttatt       120
     cttttgcccg cgatcccggc cacctccccc tacggtaacg gagaaataat ttctctgctg       180
     gaatcgtaga ttaggctctt tcaccccttc cagcgcctct gcttccacta ccccagttta       240
     tcctcgtttt gtaattacgt aggtctgggg ctctgagccc caaggcgcct cgctttcctc       300
     ccttacagcc tggcttctcc agtgaaccct ccccctgccc tctatctgca cgtccccagc       360
     ctgggaaaag atggctccac tgcccccaag gggcctggtc ccatctctgc tctggtgctt       420
     gagcctgttt ctgagcctcc caggacctgt ctggctccaa ccctctcctc ctccccatcc       480
     ttctccccga gctgagcccc atccgtgtca tacctgccgg gcactggtgg acaacttcaa       540
     caagggcctg gagagaacca tccgggacaa cttcgggggt ggaaacacgg cctgggagga       600
     agagaagttg tccaaataca aagacagtga gacccgcctg gtggaggtgc tggagggcgt       660
     gtgcagcagg tcagacttcg agtgccaccg cctgctcgag ctgagcgagg agctggtgga       720
     aaactggtgg tttcacaggc agcaggaagc ccccgacctc ttccagtggc tctgttccga       780
     ttccctgaag ctctgctgcc cctctggcac ctttgggccc tcctgcctgc catgtcctgg       840
     gggcacagag aggccctgcg gtggctacgg gcagtgtgaa ggggaaggga ctcgaggggg       900
     cagcgggcac tgtgactgcc aagccggcta tgggggcgag gcctgtggcc agtgtggcct       960
     tggctacttt gaggcggagc gcaacagcag ccatctggta tgttcggcgt gttttggtcc      1020
     ttgtgcccgc tgcacgggac ctgaggaatc ccattgtctg cagtgcaaga aaggctgggc      1080
     cctgcatcac ctcaagtgtg tagacatcga tgagtgtggt acagagcaag ccacctgtgg      1140
     agctgaccag ttctgtgtga acacagaagg atcctacgag tgccgagact gtgcaaaggc      1200
     ctgcctgggc tgtatgggag cagggccagg gcgctgcaaa aagtgcagcc gtggctacca      1260
     gcaggtgggc tccaagtgcc tagatgtgga tgagtgtgag actgtggtgt gtccaggaga      1320
     gaatgagaag tgtgaaaaca cggagggagg ctaccgctgt gtctgtgctg agggctacag      1380
     acaggaggac ggcatctgcg tgaaggagca ggtcccggag tcggcgggct tctttgcgga      1440
     gatgacggag gatgaaatgg tggttctgca gcagatgttc tttggtgtaa tcatctgtgc      1500
     gctggccacg cttgctgcca agggtgactt ggtgttcact gccatcttca ttggagctgt      1560
     ggcagccatg actgggtact ggttgtcaga gcggagtgac cgtgtgctgg agggcttcat      1620
     caagggtaga taatccctgc cgccactcac aggatttcct cccacccagg ctgctcctag      1680
     aggttatttc tctctcccta tggatacctg ggacagcata gtttctcttt gagactgggg      1740
     taaacaccct tttacctgcc ttactgagca gcccaggacc ccagtggccc cagggggttg      1800
     aaaaagaggt cctgaagcag atgccacgag atcctagcct aggacactgg caggcctcac      1860
     cgtgtatgaa tcccaagaca gtttctcccc agggaggttg caggtgggct ttggcccctg      1920
     acccggatga gaggtgtccc ctcaggggtg ggcccccata ggccccttgc caggtgcatg      1980
     ctgccagctc cagctgtgta ttcaccgccc acgccctagc catcgactta tttattcatc      2040
     tcaggaaata aaggacggtc ttgaaaatgg gaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2100
     aa                                                                     2102
//


spacer
spacer