spacer

EBI Dbfetch

ID   BC028989; SV 1; linear; mRNA; STD; MUS; 1774 BP.
XX
AC   BC028989;
XX
DT   25-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus solute carrier family 17 (sodium-dependent inorganic phosphate
DE   cotransporter), member 7, mRNA (cDNA clone IMAGE:5363081), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1774
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1774
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 300ecc3585e08fa27382bc8ac95c2017.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: d Column: 16.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 33) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1774
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="IMAGE:5363081"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1774
FT                   /gene="Slc17a7"
FT                   /note="synonym: Vglut1"
FT   CDS             <1..608
FT                   /codon_start=3
FT                   /gene="Slc17a7"
FT                   /product="Slc17a7 protein"
FT                   /db_xref="GOA:Q8JZR7"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920211"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JZR7"
FT                   /protein_id="AAH28989.1"
FT                   /translation="QIADFLRSRHIMSTTNVRKLMNCGGFGMEATLLLVVGYSHSKGVA
FT                   ISFLVLAVGFSGFAISGFNVNHLDIAPRYASILMGISNGVGTLSGMVCPIIVGAMTKHK
FT                   TREEWQYVFLIASLVHYGGVIFYGVFASGEKQPWAEPEEMSEEKCGFVGHDQLAGSDES
FT                   EMEDEAEPPGAPPAPPPSYGATHSTVQPPRPPPPVRDY"
FT   misc_difference 1704..1774
FT                   /gene="Slc17a7"
FT                   /note="polyA tail: 71 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1774 BP; 378 A; 530 C; 448 G; 418 T; 0 other;
     gccagatcgc tgactttttg cgcagtcgtc acataatgtc cactaccaac gtgcgaaagc        60
     tcatgaactg cgggggtttc gggatggaag ccacgctgct gctggtggtc ggatactcgc       120
     actccaaggg cgtggccatc tccttcctgg tcctggctgt gggcttcagt ggctttgcca       180
     tctctgggtt taacgtgaac cacttggaca tcgcccctcg ctatgccagc atcttgatgg       240
     gcatttccaa tggcgtgggc acactgtctg ggatggtgtg ccccatcatc gtgggtgcaa       300
     tgaccaagca caagacgcgg gaggagtggc agtacgtgtt cctcatagcc tccctggtgc       360
     actacggcgg tgtcatcttc tatggggtct ttgcttcggg agagaagcag ccgtgggcag       420
     agccggagga gatgagcgag gagaagtgtg gctttgttgg ccacgaccag ctggctggca       480
     gtgacgaaag tgaaatggag gacgaggctg agcccccagg ggcgcccccc gcgccgcctc       540
     cgtcctacgg ggccacacac agcacagtgc agcctccgag gcccccgccc cctgtccggg       600
     actactgacc acgggcctcc cactgtgggg cagtttccag gacttccact ccatacacct       660
     ctagcctgag cggcagtgtc gaggaacccc actcctcccc tgcctcaggc ttaagatgca       720
     agtcctccct tgttcccagt gctgtccgac cagccctctt tccctctcaa ctgcctcctg       780
     cggggggtga agctgcacac tagcagtttc aaggataccc agactcccct gaaagtcgtt       840
     ctccgcttgt ttctgcctgt gtgggctcaa atctcccctt tgagggcttt atttggaggg       900
     acagttcaac ctcttcctct cttgtggttt tgaggtttca ccccttcccc caagacccca       960
     gggattctca ggctaccccg agattattca ggtggtcccc tactcagaag acttcatggt      1020
     cgtcctctat tagtttcaag gctcgcctaa ccaattctac atttttccaa gctggtttaa      1080
     cctaaccacc aatgccgccg ttcccaggac tgattctcac cagcgtttct gagggaaaat      1140
     ggcggtttca agtcccccca cccccctttt cttccctcgt cccctcacca gcacactttg      1200
     ccgggccttg accttagctt agtacaatca ttgtccaggg aaatggccaa aatggctctg      1260
     ctcaccccgt gctctttttc tgactcagtt ttcaggtctc agtagtggct gcccaaagct      1320
     attaattcag cggctcgagg ccacctcttc ctccccgtgg tggtttcagg atccccctcg      1380
     cccccccccc cccaaatcct tgcactttat tctcctgggt ggttccaggc cgccctcggt      1440
     ttctcagtgg ccatttgttg tgtgtccctc aggggctaaa tgattccaaa tctggggtgc      1500
     ttcccctcat agacacccct ctctcaacgt agaaatctgg gtgggggtga ggtgtgtgag      1560
     agaagttaca gaatcccagg aaagggagcg gggctgggag gagagggttg ttcctggggc      1620
     agggtcgtgt cttggtgtct gtctctgtga cgtaaatcct gccctgcccc accccactcc      1680
     caataaacgc tctggtgtac ggaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      1740
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaa                                  1774
//


spacer
spacer