spacer

EBI Dbfetch

ID   BC028979; SV 1; linear; mRNA; STD; MUS; 2228 BP.
XX
AC   BC028979;
XX
DT   12-AUG-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus caspase 12, mRNA (cDNA clone MGC:36090 IMAGE:5375109),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2228
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2228
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAY-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; bf039bd01e46646d832eedd5412524dd.
DR   Ensembl-Gn; ENSMUSG00000025887; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027009; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: p Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981867.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2228
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:36090 IMAGE:5375109"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2228
FT                   /gene="Casp12"
FT   CDS             31..1290
FT                   /codon_start=1
FT                   /gene="Casp12"
FT                   /product="caspase 12"
FT                   /db_xref="GOA:O08736"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001315"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR017350"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="MGI:MGI:1312922"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08736"
FT                   /protein_id="AAH28979.1"
FT                   /translation="MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIG
FT                   ESASFILNKAENLVENFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSS
FT                   PSESKRKVEDDEMEVNAGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAK
FT                   EIYPVMEKEGRTRLALIICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQ
FT                   EMETELMQFAGRPEHQSSDSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNS
FT                   NCRSLRNKPKILIMQACRGRYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVET
FT                   DFIAFKSSTPHNISWKVGKTGSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELT
FT                   QMPTIERVSMTRYFYLFPGN"
FT   misc_difference 2205..2228
FT                   /gene="Casp12"
FT                   /note="polyA tail: 24 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2228 BP; 754 A; 392 C; 426 G; 656 T; 0 other;
     gctttttatg tccaggagtc ctgcacagcc atggcggcca ggaggacaca tgaaagagat        60
     ccaatctaca agatcaaagg tttggccaag gacatgctgg atggggtttt tgatgacctg       120
     gtggagaaga atgttttaaa tggagatgag ttactcaaaa taggggaaag tgcgagtttc       180
     atcctgaaca aggctgagaa tctggttgag aacttcttag agaaaacaga catggcagga       240
     aaaatatttg ctggccacat tgccaattcc caggaacagc tgagtttaca attttctaat       300
     gatgaggatg atggacctca gaagatatgt acaccttctt ctccatcaga atccaagaga       360
     aaagtagagg atgatgaaat ggaggtaaat gctggattgg cccatgaatc acatctaatg       420
     ctgacagctc ctcatggact ccagagctca gaagtccaag atacactgaa gctttgtcca       480
     cgtgatcagt tttgtaagat aaagacagaa agggcaaaag agatatatcc agtgatggag       540
     aaggagggac gaacacgtct ggctctcatc atctgcaaca aaaagtttga ctaccttttt       600
     gatagagata atgctgatac tgacattttg aacatgcaag aactacttga aaatcttgga       660
     tactctgtgg tgttaaagga aaaccttaca gctcaggaaa tggagacaga gttaatgcag       720
     tttgctggcc gtccagagca ccagtcctca gacagcacat tcctggtgtt tatgtcccat       780
     ggcatcctgg aaggaatctg tggggtgaag caccgaaaca aaaagccaga tgttcttcat       840
     gatgacacta tcttcaaaat tttcaacaac tctaactgtc ggagtctgag aaacaaaccc       900
     aagattctca tcatgcaggc ctgcagaggc agatataatg gaactatttg ggtatccaca       960
     aacaaaggga tagccactgc tgatacagat gaggaacgtg tgttgagctg taaatggaat      1020
     aatagtataa caaaggccca tgtggagaca gatttcattg ctttcaaatc ttctacccca      1080
     cataatattt cttggaaggt aggcaagact ggttccctct tcatttccaa actcattgac      1140
     tgcttcaaaa agtactgttg gtgttatcat ttggaggaaa tttttcgaaa ggttcaacac      1200
     tcatttgagg tcccaggtga actgacccag atgcccacta ttgagagagt atccatgaca      1260
     cgctatttct acctttttcc cgggaattag cacaggcaac tctcatgcag ttcccagtca      1320
     agtattgctg tagctgagaa gaaaagaaaa ttccaagatc ccaggatttt taaatgtgta      1380
     aaacttttca gttagatatt ttatacaata tcataaggct agataatttc cataggttat      1440
     ttttagggga aacctgatac gtaaaatttt gcatgaaaag tatagattcg ttccttcctt      1500
     ccaaatctgc tcatctttta ctttatttta ttaaatttat atttgcacat ttttgtaaaa      1560
     tgaataaagg aaaaagacac taaagaacat gtctgaacat atcctggaac ttcttctttg      1620
     taaaatgaat aaaggaaaaa gacactaaag aacaaagatg atacaccttt tgatgaacca      1680
     ctttcaccta taaattagta gtaagaattt actcacaagg aagatcttat ctacaatgta      1740
     gctgagaaat gaaactgttg catatgtagg taaaactaat catcttttag gaataagata      1800
     aagaggttta tgtccactgt ttgtctctgg catacatggt tttcatgcct agtggctacc      1860
     taccattcct ttcaatcaat ttcttaggat ataattgaca aatttatgct atgtttataa      1920
     tttttctctt aaatgctttt gtaataagat atactcacac atacacattt aagattctgt      1980
     ctattagtgt tattgaaata aatcctagaa acaaaaatta aaagtttaaa gcattaaaga      2040
     caattttgag acaaaatatt ctatgaaatt ctatgcaaaa ttgaattctt ctacaagtat      2100
     gtgatgaagc ccacctacca ctatttttgt catcttgagg atgttatatc attattttta      2160
     cttaactgag ctcaaattaa aatctttgtt tattctttgt tctaaaaaaa aaaaaaaaaa      2220
     aaaaaaaa                                                               2228
//


spacer
spacer