spacer

EBI Dbfetch

ID   BC028148; SV 1; linear; mRNA; STD; HUM; 1676 BP.
XX
AC   BC028148;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Homo sapiens tumor necrosis factor (TNF superfamily, member 2), mRNA (cDNA
DE   clone MGC:39905 IMAGE:5217636), complete cds.
XX
KW   MGC.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1676
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1676
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 01baa53721f3b0b70f3a5bc6663f9d9f.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC2118424; 17190839.
DR   EuropePMC; PMC3608437; 23340494.
DR   H-InvDB; HIT000040462_05.4.
DR   H-InvDB; HIT000040462_06.4.
DR   H-InvDB; HIT000040462_07.4.
DR   H-InvDB; HIT000040462_08.4.
DR   H-InvDB; HIT000040462_09.4.
DR   H-InvDB; HIT000040462_10.4.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Life Technologies, Inc.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 62 Row: j Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 25952110.
CC   Differences found between this sequence and the human reference
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1676
FT                   /organism="Homo sapiens"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_118"
FT                   /clone="MGC:39905 IMAGE:5217636"
FT                   /tissue_type="Blood, adult leukocytes"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:9606"
FT   gene            1..1676
FT                   /gene="TNF"
FT                   /note="synonyms: DIF, TNFSF2, TNF-alpha"
FT   CDS             158..859
FT                   /codon_start=1
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="H-InvDB:HIT000040462_04.4"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAH28148.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   misc_difference 1655..1676
FT                   /gene="TNF"
FT                   /note="polyA tail: 22 bases do not align to the human
FT                   genome."
XX
SQ   Sequence 1676 BP; 399 A; 496 C; 402 G; 379 T; 0 other;
     ggacagcaga ggaccagcta agagggagag aagcaactac agaccccccc tgaaaacaac        60
     cctcagacgc cacatcccct gacaagctgc caggcaggtt ctcttcctct cacatactga       120
     cccacggctc caccctctct cccctggaaa ggacaccatg agcactgaaa gcatgatccg       180
     ggacgtggag ctggccgagg aggcgctccc caagaagaca ggggggcccc agggctccag       240
     gcggtgcttg ttcctcagcc tcttctcctt cctgatcgtg gcaggcgcca ccacgctctt       300
     ctgcctgctg cactttggag tgatcggccc ccagagggaa gagttcccca gggacctctc       360
     tctaatcagc cctctggccc aggcagtcag atcatcttct cgaaccccga gtgacaagcc       420
     tgtagcccat gttgtagcaa accctcaagc tgaggggcag ctccagtggc tgaaccgccg       480
     ggccaatgcc ctcctggcca atggcgtgga gctgagagat aaccagctgg tggtgccatc       540
     agagggcctg tacctcatct actcccaggt cctcttcaag ggccaaggct gcccctccac       600
     ccatgtgctc ctcacccaca ccatcagccg catcgccgtc tcctaccaga ccaaggtcaa       660
     cctcctctct gccatcaaga gcccctgcca gagggagacc ccagaggggg ctgaggccaa       720
     gccctggtat gagcccatct atctgggagg ggtcttccag ctggagaagg gtgaccgact       780
     cagcgctgag atcaatcggc ccgactatct cgactttgcc gagtctgggc aggtctactt       840
     tgggatcatt gccctgtgag gaggacgaac atccaacctt cccaaacgcc tcccctgccc       900
     caatcccttt attaccccct ccttcagaca ccctcaacct cttctggctc aaaaagagaa       960
     ttgggggctt agggtcggaa cccaagctta gaactttaag caacaagacc accacttcga      1020
     aacctgggat tcaggaatgt gtggcctgca cagtgaagtg ctggcaacca ctaagaattc      1080
     aaactggggc ctccagaact cactggggcc tacagctttg atccctgaca tctggaatct      1140
     ggagaccagg gagcctttgg ttctggccag aatgctgcag gacttgagaa gacctcacct      1200
     agaaattgac acaagtggac cttaggcctt cctctctcca gatgtttcca gacttccttg      1260
     agacacggag cccagccctc cccatggagc cagctccctc tatttatgtt tgcacttgtg      1320
     attatttatt atttatttat tatttattta tttacagatg aatgtattta tttgggagac      1380
     cggggtatcc tgggggaccc aatgtaggag ctgccttggc tcagacatgt tttccgtgaa      1440
     aacggagctg aacaataggc tgttcccatg tagccccctg gcctctgtgc cttcttttga      1500
     ttatgttttt taaaatattt atctgattaa gttgtctaaa caatgctgat ttggtgacca      1560
     actgtcactc attgctgagc ctctgctccc caggggagtt gtgtctgtaa tcgccctact      1620
     attcagtggc gagaaataaa gtttgcttag aaaaaaaaaa aaaaaaaaaa aaaaaa          1676
//


spacer
spacer