Dbfetch

ID   BC027773; SV 1; linear; mRNA; STD; MUS; 3321 BP.
XX
AC   BC027773;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus a disintegrin-like and metallopeptidase (reprolysin type) with
DE   thrombospondin type 1 motif, 4, mRNA (cDNA clone MGC:38401 IMAGE:5345809),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3321
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3321
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 387c40a3faf38260d357e634718a041d.
DR   Ensembl-Gn; ENSMUSG00000006403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000111315; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: f Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 27370273.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3321
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38401 IMAGE:5345809"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3321
FT                   /gene="Adamts4"
FT                   /note="synonyms: ADMP-1, ADAM-TS4, ADAMTS-2, 3830423K05,
FT                   mKIAA0688"
FT   misc_difference 1..9
FT                   /gene="Adamts4"
FT                   /note="9 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 11
FT                   /gene="Adamts4"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             62..2563
FT                   /codon_start=1
FT                   /gene="Adamts4"
FT                   /product="a disintegrin-like and metallopeptidase
FT                   (reprolysin type) with thrombospondin type 1 motif, 4"
FT                   /db_xref="GOA:Q8BNJ2"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:1339949"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BNJ2"
FT                   /protein_id="AAH27773.1"
FT                   /translation="MSQMGLHPRRGLTGHWLRRFQPCLPLHTVQWRRLLLLAFLLSLAW
FT                   PASPLPREEEIVFPEKLNGSSILPGSGVPARLLYRLPAFGEMLLLELEQDPGVQVEGLT
FT                   VQYLGQAPEMLGGAEPGTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEG
FT                   GALNSAGGPGAHILRRKSPASSQGPMCTVKAPSGSPSPISRRTKRFASLSRFVETLVVA
FT                   DDKMAAFHGTGLKRYLLTVMAAAAKAFKHPSIRNPVNLVVTRLVILGSGQEGPQVGPSA
FT                   AQTLRSFCTWQRGLNTPNDSDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARS
FT                   CAIVEDDGLQSAFTAAHELGHVFNMLHDNSKPCTNLNGQGGSSRHVMAPVMAHVDPEEP
FT                   WSPCSARFITDFLDNGYGHCLLDKPEAPLHLPATFPGKDYDADRQCQLTFGPDSSHCPQ
FT                   LPPPCAALWCSGHLNGHAMCQTKHSPWADGTPCGSSQACMGGRCLHVDQLKDFNVPQAG
FT                   GWGPWGPWGDCSRTCGGGVQFSSRDCTRPVPRNGGKYCEGRRTRFRSCNTENCPHGSAL
FT                   TFREEQCAAYNHRTDLFKSFPGPMDWVPRYTGVAPRDQCKLTCQARALGYYYVLEPRVA
FT                   DGTPCSPDTSSVCVQGRCIHAGCDRIIGSKKKFDKCMVCGGDGSRCSKQSGSFKKFRYG
FT                   YSDVVTIPAGATHILVRQQGGSGLKSIYLALKLSDGSYALNGEYTLMPSPTDVVLPGAV
FT                   SLRYSGATAASETLSGHGPLAQPLTLQVLVAGNPQNARLRYSFFVPRPVPSTPRPPPQD
FT                   WLQRRAEILKILRKRPWAGRK"
FT   misc_difference 114
FT                   /gene="Adamts4"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'R' in cDNA, 'Q' in the mouse genome."
FT   misc_difference 658
FT                   /gene="Adamts4"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 793
FT                   /gene="Adamts4"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1612
FT                   /gene="Adamts4"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1750
FT                   /gene="Adamts4"
FT                   /note="'G' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1915
FT                   /gene="Adamts4"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1949
FT                   /gene="Adamts4"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2527
FT                   /gene="Adamts4"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2837
FT                   /gene="Adamts4"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 3026..3029
FT                   /gene="Adamts4"
FT                   /note="4 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3068
FT                   /gene="Adamts4"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 3085..3086
FT                   /gene="Adamts4"
FT                   /note="2 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3288
FT                   /gene="Adamts4"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3308..3321
FT                   /gene="Adamts4"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3321 BP; 674 A; 947 C; 943 G; 757 T; 0 other;
     ccacgcgtcc gttttggtgc cgcagatggc ctcaatccat cccagctgca gcccgggtac        60
     catgtcccag atgggcttgc atcccaggag gggcttgact gggcactggc tgcgaagatt       120
     ccaaccctgc ttgccgcttc acactgtgca gtggcggagg ctgctgctgc tggccttcct       180
     cctgtcctta gcgtggcccg ccagccccct cccccgggag gaggagatcg tgtttccaga       240
     gaagctcaat ggcagtagca tcctacctgg atcaggcgtt cctgccaggc tgctgtaccg       300
     attgccagcc tttggggaga tgttgctact agaactagaa caggaccctg gggtgcaggt       360
     agagggtttg actgtacagt acctgggcca ggcacctgag atgctgggtg gggcagagcc       420
     aggtacctac ctgactggca ccatcaatgg agatccggag tcggtggcat ctctgcactg       480
     ggacggggga gccctattag gggtactgca gtaccgtggg gccgaactcc acctccagcc       540
     tctggaagga ggcgccctta actctgctgg gggaccgggg gctcacatcc tacgccggaa       600
     gagtcctgcc agcagccaag gtcccatgtg caccgtcaag gctccttctg ggagcccaag       660
     tcccatttcc cgcagaacca agcgcttcgc ttctctgagt agattcgtgg agacactggt       720
     ggtagcagat gacaagatgg cagcattcca tggtacaggg ttaaagcgct acctgctgac       780
     ggttatggca gccgccgcta aagcctttaa acacccaagc atccgaaacc ctgtcaactt       840
     ggtggtgacg cgcctggtga tcctggggtc cggccaggaa gggccccaag tggggccaag       900
     tgccgcccag accctacgca gcttctgcac ctggcagcgg ggcctcaaca cccctaacga       960
     ctcagatcct gaccactttg acacagccat tctgttcacc cggcaggacc tgtgtggggt      1020
     ctccacttgt gacaccctgg gtatggctga tgtgggcaca gtgtgtgatc cagctaggag      1080
     ctgtgctatt gtggaagatg atgggctcca gtcagccttc actgctgctc atgaactggg      1140
     ccatgtcttc aacatgctcc atgataactc caagccatgc actaacttga atgggcaggg      1200
     gggttcctct cgccatgtca tggctcctgt catggcccat gtggaccctg aagagccctg      1260
     gtcgccctgc agtgcccgat tcatcactga cttcctggac aatggttatg ggcactgcct      1320
     cttagacaaa ccggaggctc ccctccatct accagcgact tttcctggca aggactatga      1380
     cgctgaccgc caatgccaac tgaccttcgg tcctgactca agccattgtc cacagctgcc      1440
     accgccctgt gctgccctct ggtgctctgg ccacctcaat ggccatgcca tgtgccagac      1500
     gaagcactca ccttgggctg atggcactcc ctgcgggtct tcacaggcct gcatgggtgg      1560
     ccgctgtctg cacgtggacc agctcaagga cttcaatgtt cctcaggctg gcggctgggg      1620
     cccctgggga ccatggggtg actgctccag gacttgtggg ggtggtgtcc agttctcctc      1680
     ccgggattgc acgaggcccg tcccccggaa cggtggcaag tattgtgagg gccgccggac      1740
     tcgcttccgg tcctgcaaca cggagaactg cccacacggc tcagcattga ccttccgtga      1800
     agagcagtgt gctgcctaca accaccgaac cgacctcttc aagagctttc cagggcccat      1860
     ggactgggtt ccgcgctaca caggtgtggc ccctcgagac caatgcaaac tcacttgcca      1920
     ggcccgggca ctgggctact actacgtact ggagccccgg gtggcagatg ggactccctg      1980
     ctccccagac acctcctctg tctgtgtcca gggccgctgt atccatgctg gctgtgaccg      2040
     gatcattggc tccaaaaaga aatttgacaa gtgcatggtg tgcggcgggg atggctctcg      2100
     ctgcagcaag cagtcgggct ccttcaaaaa attcaggtat ggatacagcg atgtggtcac      2160
     gatccctgcg ggggccaccc atatccttgt acggcagcag ggggggtctg gtctcaagag      2220
     catctacctg gccctgaagc tttctgacgg ttcttacgcc ctcaatggtg aatacacgct      2280
     gatgccctcc ccaacagatg tggttcttcc tggggcagtc agcttgcgct acagcggagc      2340
     cacagcagcc tcagagacac tgtctggaca tgggccgctg gcccagccct tgacgctgca      2400
     agtcctggtg gctggcaacc cacagaatgc acgtctgcgg tacagtttct ttgtcccgcg      2460
     gccagtccct tcaacaccac gccctcctcc ccaagactgg ctgcaacgca gggcagagat      2520
     actgaaaatc cttcggaagc gtccctgggc aggccggaaa taacctcact gtcccggctg      2580
     ccctttttgg gcgccggggc ctcggactca tctgggagaa tgagcaggct tctgcaactg      2640
     cctcctgcta aaacacagta gggaggtgta gagggtgaga tctgcctgcc tcactgcccc      2700
     aaaccgcagg ctggccctgc cctggcttcc tgccctggga ggcagtgatg tcttggtgaa      2760
     tggaaagggg ctaggtgaca gtaccctatc tactaaactg ccccctctac cctgcaggtc      2820
     acaggaggaa tgggggaaag acagggtggg tcctgggccc tagttgtatt tatttggtat      2880
     ttattcattt ttatttagca ccaggaaagg ggactagggt cttggggaaa ctcacccatt      2940
     atagccctaa cctagctatg aaatccaggg tgttggtgac aaatatgagt ggtgtgtgtg      3000
     tgtgtgtgtg tgtgtgtgtg tgtgtgtgtt tatgtatgag gtacaacctg ccctgctttc      3060
     ctctccccta attttttttt ttttttctgg gaaaaggaaa gtcaaaggta ggactgcctt      3120
     cagggagtaa gggatgattg tgtttttaaa ttgaagtttg ctatttatat gctctttttg      3180
     gagtcagaca aatgtgggtt atattctggc cccgcatctt tgagcattag ttttctcatg      3240
     tgccaataat aatcccttag aaattggttg taaggattaa atgatgtaaa taaagaacta      3300
     gcatagaaaa aaaaaaaaaa a                                                3321
//