spacer

EBI Dbfetch

ID   BC027772; SV 1; linear; mRNA; STD; MUS; 2777 BP.
XX
AC   BC027772;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus TAR DNA binding protein, mRNA (cDNA clone MGC:36432
DE   IMAGE:5346061), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2777
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2777
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; c5a90c3b1f95740a1ba8794469e680bd.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084125; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: f Column: 7
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543841.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2777
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:36432 IMAGE:5346061"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2777
FT                   /gene="Tardbp"
FT   misc_difference 1..9
FT                   /gene="Tardbp"
FT                   /note="9 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             91..1335
FT                   /codon_start=1
FT                   /gene="Tardbp"
FT                   /product="TAR DNA binding protein"
FT                   /db_xref="GOA:Q921F2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="PDB:3D2W"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921F2"
FT                   /protein_id="AAH27772.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNPG
FT                   GFGNQGGFGNSRGGGAGLGNNQGGNMGGGMNFGAFSINPAMMAAAQAALQSSWGMMGML
FT                   ASQQNQSGPSGNNQSQGSMQREPNQAFGSGNNSYSGSNSGAPLGWGSASNAGSGSGFNG
FT                   GFGSSMDSKSSGWGM"
FT   misc_difference 2732..2777
FT                   /gene="Tardbp"
FT                   /note="polyA tail: 46 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2777 BP; 776 A; 469 C; 708 G; 824 T; 0 other;
     ccacgcgtcc gcggctgttg tcggattcct tcccgtctgt gcttcctcct tgtgcttcct        60
     agcagtggcc tagcggagat ttaagcaaag atgtctgaat atattcgggt aacagaagat       120
     gagaacgatg aacccattga aataccatca gaagacgatg ggacggtgtt gctgtccaca       180
     gttacagccc agtttccagg ggcatgcggc ctgcgctacc ggaatcccgt gtctcagtgt       240
     atgagaggag tccgactggt ggaaggaatt ctgcatgccc cagatgctgg ctggggcaat       300
     ctggtatatg ttgtcaacta tcccaaagat aacaaaagga aaatggatga gacagatgct       360
     tcctctgcag tgaaagtgaa aagagcagtc cagaaaacat ctgacctcat agtgttgggt       420
     ctcccctgga aaacaactga gcaggatctg aaagactatt tcagtacttt tggagaggtt       480
     cttatggttc aggtcaagaa agatcttaaa actggtcact cgaaagggtt tggctttgtt       540
     cgatttacag aatatgaaac ccaagtgaaa gtaatgtcac aacgacatat gatagatggg       600
     cgatggtgtg actgtaaact tcccaactct aagcaaagcc cagacgagcc tttgagaagc       660
     agaaaggtgt ttgttggacg ttgtacagag gacatgactg ctgaagagct tcagcagttt       720
     ttctgtcagt atggagaagt ggtagatgtc ttcattccca aaccattcag agcttttgcc       780
     ttcgtcacct ttgcagatga taaggttgcc cagtctcttt gtggagagga tttgatcatt       840
     aaaggaatca gcgtgcatat atccaatgct gaacctaagc ataatagcaa tagacagtta       900
     gaaagaagtg gaagatttgg tggtaatcca ggtggctttg ggaatcaggg tgggtttggt       960
     aacagtagag ggggtggagc tggcttggga aataaccagg gtggtaatat gggtggaggg      1020
     atgaactttg gtgcttttag cattaaccca gcgatgatgg ctgcggctca ggcagcgttg      1080
     cagagcagtt ggggtatgat gggcatgtta gccagccagc agaaccagtc gggcccatct      1140
     gggaataacc aaagccaggg cagcatgcag agggaaccaa atcaggcttt tggttctgga      1200
     aataattcct acagtggttc taattctggt gccccccttg gttgggggtc agcatcaaat      1260
     gcaggatcgg gcagtggttt taatgggggc tttggctcga gcatggattc taagtcttct      1320
     ggctggggaa tgtaggtggt ggggggtggt tagtaggttg gttattaggt taggtagatt      1380
     tagaatggtg ggattcaaat ttttctaaac tcatggtaag tatattgtaa aatacatatg      1440
     tactaaaatt ttcagattgg tttgttcagt gtggagtata ttcagcagta tttttgacat      1500
     ttttctttag aaaaaaagag gggaaagcta aatgaatttt ataagttttg ttatataaag      1560
     ggttaaaata ctgagtgggt gaaagtgaac tgctgtttgc ctaattggta aaccaacact      1620
     acaattgatc tcagaaggtt tctctgtaat attctatcat tgaaattgtt aatgaattct      1680
     ttgcatgttc agagtagaaa ccattggtta gaactacatt cttttctcct tattttaatt      1740
     tgaatcccac cctatgaatt ttttccttag gaaaatctcc atttgggaga tcatgatgtc      1800
     atggtgtttg attcttttgg ttttgttttt aacacttgtc ttccttcata tacgaaagta      1860
     caatatgaag ccttcattta atctctgcag ttcatctcat ttcaaatgtt tatggaagaa      1920
     gcacttcatt gaaagtagtg ctgtaaatat tctgccatag gaatacttct gtctacatgc      1980
     tttctcatcc aagaattcgt catcacgctg cacaggctgc gtctttgacg gtgggtgttc      2040
     catttttatc cgctactctt tatttcatgg agtcgtatca acgctatgaa cgcaaggctg      2100
     tgatatggaa ccagaaggct gtttgaactt ttgaaacctt gtgtgggatt gatggtggtg      2160
     ccgaggcatg aaaggctagt atgagcgaga aaaggagagc gcgtgcagag acttggtggt      2220
     ggaaaatgga tattttttaa cttggagaga tgtgtcactc aatcctgtgg ctttggtgag      2280
     agagtgtgca gagagcaatg atagcaaata acgtacgaat gttttacatc aaaggacatc      2340
     cacatcagtt ggaagacttt gagttttgtt cttaggaaac ccactttagt tgaatgtgtt      2400
     aagtgaaata cttgtacttc cctccccctc tgtcaactgc tgtgaatgct gtatggtgtg      2460
     tgttctcctc tgttactgat ctggaagtgt gggaacgtga actgaagctg atgggctgcg      2520
     aacatggact gagcttgtgg tgtgctttgc aggagaactt ggaagcagag ttcaccagtg      2580
     agctcaggtg tctcaaagaa gggtggaagt tctcatgtct gttagctatt cataagaatg      2640
     ctgtttgctg cagttctgtg tcctgtgctt ggatgctttt ttataagagt tgtcattgtt      2700
     ggaaattctt aaataaaact gatttaaata aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      2760
     aaaaaaaaaa aaaaaaa                                                     2777
//


spacer
spacer