spacer

EBI Dbfetch

ID   BC027530; SV 1; linear; mRNA; STD; MUS; 1161 BP.
XX
AC   BC027530;
XX
DT   03-MAY-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus apolipoprotein B mRNA editing enzyme, catalytic polypeptide 2,
DE   mRNA (cDNA clone MGC:41184 IMAGE:1433092), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1161
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1161
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (08-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; b81b0bcbf68ace5ef41bef8cb3576a17.
DR   Ensembl-Gn; ENSMUSG00000040694; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046549; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Marcelo Bento Soares, Ph.D.
CC   cDNA Library Preparation: M. Bento Soares, University of Iowa
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 67 Row: g Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6753097.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1161
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="Soares_NMPu"
FT                   /clone="MGC:41184 IMAGE:1433092"
FT                   /tissue_type="Uterus, pregnant mouse"
FT                   /note="Vector: pT7T3-Pac"
FT                   /db_xref="taxon:10090"
FT   gene            1..1161
FT                   /gene="Apobec2"
FT                   /note="synonym: Arp1"
FT   CDS             30..704
FT                   /codon_start=1
FT                   /gene="Apobec2"
FT                   /product="apolipoprotein B mRNA editing enzyme, catalytic
FT                   polypeptide 2"
FT                   /db_xref="GOA:Q9WV35"
FT                   /db_xref="InterPro:IPR013158"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="MGI:MGI:1343178"
FT                   /db_xref="PDB:2RPZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WV35"
FT                   /protein_id="AAH27530.1"
FT                   /translation="MAQKEEAAEAAAPASQNGDDLENLEDPEKLKELIDLPPFEIVTGV
FT                   RLPVNFFKFQFRNVEYSSGRNKTFLCYVVEVQSKGGQAQATQGYLEDEHAGAHAEEAFF
FT                   NTILPAFDPALKYNVTWYVSSSPCAACADRILKTLSKTKNLRLLILVSRLFMWEEPEVQ
FT                   AALKKLKEAGCKLRIMKPQDFEYIWQNFVEQEEGESKAFEPWEDIQENFLYYEEKLADI
FT                   LK"
FT   misc_difference 383
FT                   /gene="Apobec2"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1129..1161
FT                   /gene="Apobec2"
FT                   /note="polyA tail: 33 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1161 BP; 335 A; 287 C; 295 G; 244 T; 0 other;
     cctctccaca tttcggccac agttcctcca tggctcagaa ggaagaggcc gctgaggctg        60
     cggcgccagc ctctcagaat ggagatgatt tggagaacct ggaagaccct gagaagctga       120
     aagagctgat cgatcttccg cccttcgaga ttgtcactgg ggtgcggcta ccagtcaact       180
     tcttcaagtt tcagttccgg aacgtggaat acagttccgg gcggaataag acctttctct       240
     gctatgtggt cgaagtacag agtaagggcg gccaagcgca ggcgacgcag ggctacctgg       300
     aggatgaaca cgcaggtgcc cacgccgagg aggctttctt taacaccatc ctgccagctt       360
     tcgacccggc cctcaagtac aacgtcacct ggtatgtgtc ctccagcccc tgtgcagcct       420
     gcgctgaccg gattctcaaa accctcagca agactaagaa ccttcgtctg ctcattctgg       480
     tgagccggct cttcatgtgg gaggagccag aggtccaggc cgctctgaaa aagctgaagg       540
     aggccggctg caaacttcgc atcatgaaac cccaggactt cgagtacatc tggcagaatt       600
     ttgtggagca agaagagggt gaatccaagg cctttgagcc ctgggaggac attcaggaga       660
     acttcctata ctatgaggag aagttggcag acatcctgaa gtaggcaaca gagctcggcc       720
     ttccagtttt acctgctgcc actcagagca atgacccgga tgccatccag gacatacctg       780
     gcttcctgat tctacttgga gttggacatc tgacactaac cagttgcact ggacaagacc       840
     ctctctcaga gaactcaaaa catacctcgg gacgtcattc attcattcaa tcatgccttc       900
     tgtaatacgg ctatcagaag aaggaaaatg aagacaagaa aaacaactgt gatgtgggca       960
     gcaggtacct gggggtggag ggtcttattg cctctccagg ggtgctgcct gagacaaaga      1020
     tcctcagtca aggtacagac ctttgaaata cagctagaaa agtgttctga attgggctga      1080
     ctttttaaaa aagacaaaat agcaacatca ataaaggaaa taagtggtaa aaaaaaaaaa      1140
     aaaaaaaaaa aaaaaaaaaa a                                                1161
//


spacer
spacer