spacer

EBI Dbfetch

ID   BC027427; SV 1; linear; mRNA; STD; MUS; 1700 BP.
XX
AC   BC027427;
XX
DT   17-AUG-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus STIP1 homology and U-Box containing protein 1, mRNA (cDNA
DE   clone MGC:35920 IMAGE:4191866), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1700
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1700
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000039615; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044911; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 61 Row: j Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981018.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1700
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:35920 IMAGE:4191866"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1700
FT                   /gene="Stub1"
FT                   /note="synonym: Chip"
FT   CDS             509..1423
FT                   /codon_start=1
FT                   /gene="Stub1"
FT                   /product="STIP1 homology and U-Box containing protein 1"
FT                   /db_xref="GOA:Q9WUD1"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1891731"
FT                   /db_xref="PDB:2C2L"
FT                   /db_xref="PDB:2C2V"
FT                   /db_xref="PDB:3Q47"
FT                   /db_xref="PDB:3Q49"
FT                   /db_xref="PDB:3Q4A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUD1"
FT                   /protein_id="AAH27427.1"
FT                   /translation="MKGKEEKEGGARLGTGGGGSPDKSPSAQELKEQGNRLFVGRKYPE
FT                   AAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQC
FT                   QLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESELH
FT                   SYLTRLIAAERERELEECQRNHEGHEDDGHIRAQQACIEAKHDKYMADMDELFSQVDEK
FT                   RKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL
FT                   IPNLAMKEVIDAFISENGWVEDY"
FT   misc_difference 1669
FT                   /gene="Stub1"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1673..1700
FT                   /gene="Stub1"
FT                   /note="polyA tail: 28 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1700 BP; 353 A; 486 C; 541 G; 320 T; 0 other;
     ggccgcaggc agctcctccc gattcccgag gaagcccctc gagagcggtc tgatctgcgg        60
     gcctctcttc taccctcaat tccgccttcc taccggcggt ccagacgttc ccaggctgtc       120
     gcgtgagccc gtgtgtgccc tggtggtgcg ctaggacccg ggcctagtga ccggccctcg       180
     gaaggccact tctcaatgac cgctgccacg ttcgcccagc ttggggccgg agggcggggc       240
     ttgagcgccg atgggcggag ccttggtctg agcagggtag gtctcggtta ctgtagggcg       300
     gggcctgtag agcgcggcgg aagcttctca gagctaaggg aactggctca atccacgagg       360
     ctccgccttt gctcacgtgt ccccatgcca gctccgcccc acaccggaag ttccggtggc       420
     ggatcgccga ccgggcggag ctgatcgctg cgcgggctgc gagatctagg tggccgggcg       480
     cggagcccaa gccgtgccgc gcggcgccat gaagggcaag gaggaaaagg agggcggcgc       540
     gcggctgggc actggtggcg gcggcagccc tgataagagc ccgagtgcgc aagagctcaa       600
     ggagcaggga aaccggctct tcgtgggccg caagtacccg gaggcggcgg cctgctacgg       660
     ccgcgccatc actcggaacc cacttgtggc agtgtactac actaaccggg ccctgtgcta       720
     tctgaagatg cagcagcctg aacaggcact tgctgactgc cggcgagccc tggagctgga       780
     cgggcagtct gtgaaggcgc acttcttcct ggggcagtgc cagctggaga tggagagtta       840
     tgatgaggcc attgccaatc tgcagcgagc ctatagtttg gccaaggagc agcgactcaa       900
     ctttggggat gatattccta gtgcccttcg cattgctaag aagaagcgct ggaacagtat       960
     cgaggaacgg cgcatccacc aggagagtga gctgcattca tatctcacca ggctcattgc      1020
     tgctgagcga gagagggaac tggaggagtg tcagcggaac cacgagggtc atgaagatga      1080
     tggccacatc cgggcccagc aggcctgcat tgaggccaag cacgataaat acatggcaga      1140
     tatggatgag ctcttctctc aggtggacga gaaaagaaag aagcgagata tccctgacta      1200
     cttgtgtggc aagattagct ttgagctgat gcgggaaccc tgcattacac ccagtggtat      1260
     cacctatgac cgcaaggaca ttgaggagca cctgcagcgt gtgggccact ttgaccctgt      1320
     gacccggagc cctctgaccc aggaacagct catccccaac ttggccatga aggaagtcat      1380
     tgacgctttc atctctgaga acggctgggt agaggactat tgaggcccca tgtcctgcct      1440
     ggcaccctgg cccaggagga tctggagacg gaagctccag tccctgtata gtttgtgtcc      1500
     ctgggcctgc ccccatcggc cctgctgatg ggttctgaac tgctcccctt ctcagcatac      1560
     cccttgctgg accatgagcc tcccttgtcc cccttctggg ctggagagtg ggtgagggtg      1620
     ggctgaggtt gctgctgctg ccactgtcct gtaataaagt ctgtgagccc taaaaaaaaa      1680
     aaaaaaaaaa aaaaaaaaaa                                                  1700
//


spacer
spacer