spacer

EBI Dbfetch

ID   BC027325; SV 1; linear; mRNA; STD; MUS; 2838 BP.
XX
AC   BC027325;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus protein-O-mannosyltransferase 1, mRNA (cDNA clone MGC:28136
DE   IMAGE:3981366), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2838
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2838
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000039254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036473; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 36 Row: e Column: 16
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21553106.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2838
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:28136 IMAGE:3981366"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2838
FT                   /gene="Pomt1"
FT   CDS             24..2264
FT                   /codon_start=1
FT                   /gene="Pomt1"
FT                   /product="protein-O-mannosyltransferase 1"
FT                   /db_xref="GOA:Q8R2R1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="MGI:MGI:2138994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2R1"
FT                   /protein_id="AAH27325.1"
FT                   /translation="MGSHSTGLEETLGVLPSWLFCKMLRFLKRPLVVTVDINLNLVALT
FT                   GLGLLTRLWQLSYPRAVVFDEVYYGQYISFYMKRIFFLDDSGPPFGHMLLALGGWLGGF
FT                   DGNFLWNRIGAEYSSNVPIWSLRLLPALAGALSVPMAYQIVLELHFSHGAAIGAALLML
FT                   IENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWLWLLLTGVSCSCA
FT                   VGIKYMGIFTYLLVLGIAAVHAWNLIGDQTLSNMRVLSHLLARIVALLVVPVFLYLLFF
FT                   YVHLMLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLKSVSGKPLPCW
FT                   LHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGD
FT                   IVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNRDTW
FT                   KTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSPGYHESMVWNVEEHRYGK
FT                   SHEQKERELELHSPTQLDISRNLSFMARFSELQWKMLTLKNEDLEHQYSSTPLEWLTLD
FT                   TNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSR
FT                   WVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCRSQLQ
FT                   RNVFSALVVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDILIRK"
FT   misc_difference 2826..2838
FT                   /gene="Pomt1"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2838 BP; 638 A; 822 C; 721 G; 657 T; 0 other;
     gcggttcgca ggcctggctc cacatgggga gccactctac gggactcgaa gaaacgctcg        60
     gagtcctccc gagctggctt ttctgcaaaa tgttaagatt tttgaaacgg cctctagtgg       120
     tgactgttga catcaatttg aacttggtag ctctgactgg cctgggacta cttacccgac       180
     tatggcaact ctcctaccct cgggctgtgg ttttcgatga agtatattat gggcagtaca       240
     tttccttcta catgaagcgc atcttctttc tggatgacag tgggccacca tttggccaca       300
     tgctactggc cttaggaggt tggttagggg gattcgatgg taactttctg tggaaccgaa       360
     ttggagcaga gtacagtagc aatgtgccta tatggtcctt acgcctgctg ccagcgcttg       420
     ccggggccct gtcagtgccc atggcctacc agatagtgct agagctccac ttttcccacg       480
     gtgctgccat tggagccgcc ctgctgatgc tcattgagaa cgccctgatc actcagtcca       540
     ggctcatgct gttggagtcc atactgatat tttttaacct gttggctgtg ttgtcctatc       600
     tgaagttctt caactcccag acacacagcc ctttctcagt gcactggtgg ctgtggctac       660
     tgctgaccgg ggtctcttgt tcctgtgcag ttgggatcaa atacatgggg attttcacct       720
     acctgcttgt gctcggcatt gcagctgtcc acgcgtggaa tctgatcgga gaccagacct       780
     tgtcaaatat gcgcgtgctc agtcacttgc tcgccagaat cgtggctctg ctggtcgtcc       840
     cagtcttcct gtacttactc ttcttctatg tccacctgat gctgctctac cgctctgggc       900
     cccatgacca aatcatgtcc agtgccttcc aggccagctt ggagggaggg cttgcccgca       960
     tcacccaagg ccagcccctg gaggtggcct ttggttccca ggtcactctg aagagcgtct      1020
     ctggcaaacc cttgccctgc tggcttcatt cgcacaagaa cacctatccc atgatatatg      1080
     agaatggccg tggcagctcc caccagcaac aggtgacctg ttatcccttc aaagacatca      1140
     ataactggtg gatcgtcaag gatcctgggc gacaccagct ggtggtaaac aaccctcccc      1200
     ggcctgtaag acatggagac attgtacagc tcgttcacgg catgaccacc cgcctcctta      1260
     acacgcacga tgtcgcagcc ccactgagcc cccattctca agaagtctcc tgctacattg      1320
     actataacat ctccatgcct gcccagaacc tctggaaact ggacattgtg aacagagagt      1380
     ccaaccggga tacctggaag actatcttgt cggaagtgcg ctttgtacat gtgaacacat      1440
     ccgccatctt gaagctgagc ggggctcacc tccctgactg ggggttccgg cagttggagg      1500
     tagttgggga gaagttgtca ccgggctacc acgagagcat ggtgtggaat gtggaagaac      1560
     accggtatgg caaaagccat gagcagaagg agagggagct ggagctccac tcgcccactc      1620
     agctcgatat cagcaggaac ctcagcttca tggccagatt ctcagagtta cagtggaaga      1680
     tgctgacgct gaagaatgag gacttggaac accagtacag ctccaccccg ctggagtggc      1740
     tcacgctgga caccaacatc gcctattggc tacatcccag gaccagtgct cagatccact      1800
     tgcttgggaa cattgtgatc tggacttcag ccagccttgc cacagtggtc tacactctac      1860
     tcttcttctg gtacctgctc cgccggcgaa ggagcatctg tgacctccct gaggatgcct      1920
     ggtcccgctg ggtgctggct ggagccctgt gtactggcgg ctgggcactc aactacctgc      1980
     ccttcttcct gatggagagg gtgctcttcc tctaccacta cttgccggca ctcaccttcc      2040
     agatcctgct gctcccgatt gtcctgcagc acgccagcga ccatctgtgc aggtcccagc      2100
     tgcagaggaa tgtcttcagt gccctggttg tagcatggta ttcctccgca tgccatgtgt      2160
     ccaacatgct acgcccacta acctatgggg acacgtcact ctcaccaggc gagctccggg      2220
     cccttcgctg gaaagacagc tgggatattc tgatccgaaa gtaatagaga acaagaacac      2280
     agaagacaag cacacaggac aaagcctcaa agatgtgttt gtctcccacc aacaggagcc      2340
     tcagcaggca ggactgccag ggtccaggag gaactccagg gactaattcc aatttcacct      2400
     caagagccct gtccactggt tccttgtttg aagcaattga tttctcttca cacagtgaag      2460
     aatgtgccca gccacagcgt tacccatgag gcccaactct gacccagcca gagtttgagc      2520
     tgccagtgta ggaaccacca aggcaggagg ggcacccagc cagggaagga gtggggggga      2580
     ctcaggacga gctgcgggcc tactataggg ccttagccct gtcatttatg gggcccacag      2640
     tgccacacct cattgggcac aggcacagcc accctctgta aaccctgaaa gctgccagcc      2700
     atccacagac tcctgagcca actctaaaga gtcctgggag actgcagcca cctaactgcc      2760
     acggccaagg tgtcgtccat tcacttcctt acctttaatg taaataaaac aggacaaatt      2820
     gttaaaaaaa aaaaaaaa                                                    2838
//


spacer
spacer