spacer

EBI Dbfetch

ID   BC027245; SV 1; linear; mRNA; STD; MUS; 3189 BP.
XX
AC   BC027245;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, pi, mRNA (cDNA
DE   clone MGC:28005 IMAGE:3602400), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3189
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3189
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; fd7152a2c2cc752ba5fa70318de3df0d.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 35 Row: o Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981871.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3189
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:28005 IMAGE:3602400"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3189
FT                   /gene="Gabrp"
FT                   /note="synonym: MGC38123"
FT   CDS             162..1484
FT                   /codon_start=1
FT                   /gene="Gabrp"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW7"
FT                   /protein_id="AAH27245.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   misc_difference 314
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2878
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2889
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3006
FT                   /gene="Gabrp"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3008..3015
FT                   /gene="Gabrp"
FT                   /note="8 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3150
FT                   /gene="Gabrp"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3176..3189
FT                   /gene="Gabrp"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3189 BP; 842 A; 760 C; 666 G; 921 T; 0 other;
     cttaacaccc aaagagtcag gactgagatg aaaaggaccc tggagaccca aaagagtatg        60
     ctctgtgtga gagtcctgcc tgagatctgg aaacacctgc tgtaacagct gcctggtgat       120
     tcctccttca acctttttgt gtgtgaatca gctccttcaa catgagctac agcctctatt       180
     tggccttcct gtgtctgagt ctcctcactc agaggacgtg catccagggg aaccaggtca       240
     atgtggaggt cagcagaagt gacaagcttt ccttacctgg ctttgagaac ctcactgcag       300
     gatataacaa atttctcagg cccaatttcg gtggtgaccc agttcggata gcactgactc       360
     tggacatcgc cagcatctct agcatctcag agagtaacat ggactacaca gccactatat       420
     acctccggca gcgttggaca gacccacggc tagtgttcga aggcaacaag agctttactc       480
     tagatgcccg ccttgtggag ttcctctggg tgccagacac ttacattgta gagtccaaga       540
     agtccttcct ccatgaagtc acagtgggaa acaggctcat ccgcctcttc tccaacggca       600
     cagtcctgta cgcacttaga atcacaacaa cagttacatg taacatggat ctgtctaaat       660
     accccatgga cacacagacc tgcaagctgc agctagaaag ttggggatac gatggcaatg       720
     atgtggagtt ctcctggctg agagggaatg actcggtgcg tggacttgaa aacctgcgcc       780
     ttgctcagta cacaatccaa cagtatttca ccctggtcac cgtatcccag caggagacag       840
     gaaactatac gagattggtt ttgcaatttg agcttcggag gaacgtcctg tatttcattc       900
     tggaaaccta tgtcccttcc accttcctgg tggtgttatc ctgggtctcc ttttggatct       960
     ccctcgattc agttcctgcg agaacctgca ttggagtgac aacggtgtta tccatgacaa      1020
     cgctgatgat cggctcccgc acatccctac ccaacaccaa ctgcttcata aaggccatcg      1080
     atgtgtacct aggcatctgc ttcagcttcg tgtttggggc cttactggag tatgcagttg      1140
     ctcactacag ctccttacag cagatggcag tcaaagatag ggggccagcg aaggactcgg      1200
     aagaagtcaa tatcaccaac atcatcaaca gctccatctc cagctttaaa cggaagatta      1260
     gctttgccag cattgaaatc tctggtgaca atgtcaacta tagtgacttg acaatgaaag      1320
     ccagcgacaa gtttaagttt gtcttccgag agaagatcag cagaatcatt gattatttca      1380
     caattcaaaa ccccagcaat gtggatcgat actccaaact actatttcct ttgattttta      1440
     tgttggccaa tgtattttac tgggcatact acatgtattt ttgagacgcc attgaactct      1500
     tgcatcacat aatgaggtta agggtattct agaacatgtg tgtgcacttc agcttagaaa      1560
     gctacaaatg ggctaatgta acaattattc taagttgtgt agaagcccta gtgtgaccag      1620
     attctataat agagtcatta taaggcaacc cttttcttct tcaattttgg acagaacacc      1680
     ccctccacac acatacacag aacccaagac tgcgaaccta ctcagggcta tttgctctct      1740
     ggatccctgg tctgcattca ctccataaaa atgtgggaag atgattacat atattaaggg      1800
     gtttattttc taaagaattc atagtgccac tgattacatc tctgtggccc ttataatatg      1860
     ctctcttgcc tatttaaaca ccagtgtttt ctaatttttg tttttccttg aaatatgaaa      1920
     tgtgggtttg cgtcaattca ttggtggtta ccttgcctca tcaacctaat accagatggg      1980
     ttcttagtgt tatttaatac cacagaagaa ttgtccccaa attctaatac atcctattat      2040
     tcacaaatca gatgtaaatg aataaaatta gtggatcaat aaactaaaag aaaaaaacat      2100
     aaatcctttg gggtccaggg cttcatgccg tttttccacg tatcttatta ttttgttttt      2160
     atacacctta gtcctaacct atgtaaaaac cccttttcca catcaggaaa acgggaggaa      2220
     gttttgaaac ttgttctgga ttcctaatac agaatgcgtc catgaagact tgctgagtca      2280
     agtgtactag ctagccacct ttactcacat actggctagg aaccaagtag accagagagt      2340
     gctctgtcaa cctgtcctct ctgctgacct gttgaccaag atgctgggga acattttgcc      2400
     ggtggcaaag gccctgcctc cttcaaagag gagcttttat ccctgtgctc cagtgactag      2460
     gcaggagtga tgtctattag ataagaagcg gcactactgg gacacaagta gcttatctta      2520
     aatagttacc ttttcccaac ctttctagct ggactacttt gagtggatta ccctgcctga      2580
     gcagcagacc actggccctg actggttccg actgttctga acgatggaaa gacacattgc      2640
     acaacccacg tgagctgtct tttctgagtt cagccagggt caccctgacc taggagctct      2700
     tgtgtgccct ctctctctct tgctccacgg gaatcgccta tataaggttc caatgcagcc      2760
     tcaattgttt caaagactct tgctgtcttc aggtctttcc cttccttttc taatgaaccc      2820
     tcagctttcc ctgtcctttc tacaacaaac cggggctgta gatgttcttt cctttcatgt      2880
     ccttcaccta cgggccctcc ttttcatcag catggctctg cccatcgttc cgtttctgtg      2940
     agcttgagtg cctggcgctt aacagatgtt tctattttag gattcgcttt gttcattgga      3000
     gtacactctt aagctaggtg tagttgcgcc attagagttc ttagtagaat ctctttgtat      3060
     tttgtatctg tcatatacat tcctaagggg aggggctagg ggaggggaag tgtggttgag      3120
     tgagtaggtc atacctgtgc atttttttta aaaaataaaa atgtttaaaa tataaaaaaa      3180
     aaaaaaaaa                                                              3189
//


spacer
spacer