Dbfetch

ID   BC027105; SV 1; linear; mRNA; STD; MUS; 1933 BP.
XX
AC   BC027105;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus TAR DNA binding protein, mRNA (cDNA clone MGC:36467
DE   IMAGE:5359082), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1933
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1933
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 309aa9c08332a850690a68c761ce19e9.
DR   Ensembl-Gn; ENSMUSG00000041459; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029129; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029094; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029042; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0028831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028244; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0028793; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0028942; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0028906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0028933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029591; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0027964; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028324; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000105699; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0069263; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0069327; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0069233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0069244; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0068913; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0069740; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0069381; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0068853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0068989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0068889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0069076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0068906; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0069924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0068877; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0068077; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 54 Row: j Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543841.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1933
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:36467 IMAGE:5359082"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1933
FT                   /gene="Tardbp"
FT   CDS             93..980
FT                   /codon_start=1
FT                   /gene="Tardbp"
FT                   /product="TAR DNA binding protein"
FT                   /db_xref="GOA:Q8R0B4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:2387629"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R0B4"
FT                   /protein_id="AAH27105.1"
FT                   /translation="MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRN
FT                   PVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTS
FT                   DLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMS
FT                   QRHMIDGRWCDCKLPNSKQSPDEPLRSRKVFVGRCTEDMTAEELQQFFCQYGEVVDVFI
FT                   PKPFRAFAFVTFADDKVAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGVHLI
FT                   SNVYGRSTSLKVVL"
FT   misc_difference 1905..1933
FT                   /gene="Tardbp"
FT                   /note="polyA tail: 29 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1933 BP; 543 A; 346 C; 481 G; 563 T; 0 other;
     cggagcggta gcgcggctgt tgtcggattc cttcccgtct gtgcttcctc cttgtgcttc        60
     ctagcagtgg cctagcggag atttaagcaa agatgtctga atatattcgg gtaacagaag       120
     atgagaacga tgaacccatt gaaataccat cagaagacga tgggacggtg ttgctgtcca       180
     cagttacagc ccagtttcca ggggcatgcg gcctgcgcta ccggaatccc gtgtctcagt       240
     gtatgagagg agtccgactg gtggaaggaa ttctgcatgc cccagatgct ggctggggca       300
     atctggtata tgttgtcaac tatcccaaag ataacaaaag gaaaatggat gagacagatg       360
     cttcctctgc agtgaaagtg aaaagagcag tccagaaaac atctgacctc atagtgttgg       420
     gtctcccctg gaaaacaact gagcaggatc tgaaagacta tttcagtact tttggagagg       480
     ttcttatggt tcaggtcaag aaagatctta aaactggtca ctcgaaaggg tttggctttg       540
     ttcgatttac agaatatgaa acccaagtga aagtaatgtc acaacgacat atgatagatg       600
     ggcgatggtg tgactgtaaa cttcccaact ctaagcaaag cccagacgag cctttgagaa       660
     gcagaaaggt gtttgttgga cgttgtacag aggacatgac tgctgaagag cttcagcagt       720
     ttttctgtca gtatggagaa gtggtagatg tcttcattcc caaaccattc agagcttttg       780
     ccttcgtcac ctttgcagat gataaggttg cccagtctct ttgtggagag gatttgatca       840
     ttaaaggaat cagcgtgcat atatccaatg ctgaacctaa gcataatagc aatagacagt       900
     tagaaagaag tggaagattt ggtgttcatc tcatttcaaa tgtttatgga agaagcactt       960
     cattgaaagt agtgctgtaa atattctgcc ataggaatac ttctgtctac atgctttctc      1020
     atccaagaat tcgtcatcac gctgcacagg ctgcgtcttt gacggtgggt gttccatttt      1080
     tatccgctac tctttatttc atggagtcgt atcaacgcta tgaacgcaag gctgtgatat      1140
     ggaaccagaa ggctgtttga acttttgaaa ccttgtgtgg gattgatggt ggtgccgagg      1200
     catgaaaggc tagtatgagc gagaaaagga gagcgcgtgc agagacttgg tggtggaaaa      1260
     tggatatttt ttaacttgga gagatgtgtc actcaatcct gtggctttgg tgagagagtg      1320
     tgcagagagc aatgatagca aataacgtac gaatgtttta catcaaagga catccacatc      1380
     agttggaaga ctttgagttt tgttcttagg aaacccactt tagttgaatg tgttaagtga      1440
     aatacttgta cttccctccc cctctgtcaa ctgctgtgaa tgctgtatgg tgtgtgttct      1500
     cctctgttac tgatctggaa gtgtgggaac gtgaactgaa gctgatgggc tgcgaacatg      1560
     gactgagctt gtggtgtgct ttgcaggaga acttggaagc agagttcacc agtgagctca      1620
     ggtgtctcaa agaagggtgg aagttctcat gtctgttagc tattcataag aatgctgttt      1680
     gctgcagttc tgtgtcctgt gcttggatgc ttttttataa gagttgtcat tgttggaaat      1740
     tcttaaataa aactgattta aataatatgt gtctttgttt tgcagccctg aatgcaaaga      1800
     attcatagca gttaattccc ctttttgacc cttttgagat ggaactttca taaagtttct      1860
     tggcagtagt ttattttgct tcaaataaac ttatttgaaa agttaaaaaa aaaaaaaaaa      1920
     aaaaaaaaaa aaa                                                         1933
//