Dbfetch

ID   BC027050; SV 1; linear; mRNA; STD; MUS; 2901 BP.
XX
AC   BC027050;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus phosphodiesterase 6C, cGMP specific, cone, alpha prime, mRNA
DE   (cDNA clone MGC:38745 IMAGE:5358611), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2901
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2901
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 93f0845207fd17d4031de9f243ca8bfc.
DR   Ensembl-Gn; ENSMUSG00000024992; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025089; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025065; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025063; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024822; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025504; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024289; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024931; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024892; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025017; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025562; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024041; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024356; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000025956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112329; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0051652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0051669; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0051615; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0051613; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051345; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052103; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0051477; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051286; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0051392; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051344; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0051508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051340; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052229; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051089; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0050628; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 54 Row: i Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 15809035.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2901
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:38745 IMAGE:5358611"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2901
FT                   /gene="Pde6c"
FT   CDS             166..2676
FT                   /codon_start=1
FT                   /gene="Pde6c"
FT                   /product="Pde6c protein"
FT                   /db_xref="GOA:Q91ZQ1"
FT                   /db_xref="InterPro:IPR002073"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR023088"
FT                   /db_xref="InterPro:IPR023174"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="MGI:MGI:105956"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91ZQ1"
FT                   /protein_id="AAH27050.1"
FT                   /translation="MGEISQEAVERYLEKNPCFAKEYFDKKLRVEALGVIFKNSHAGVQ
FT                   TGLSLPEMTQVEESAVCLELLQCMQDEAGSAEQMAHRALQRLAQLLQADCCSMFSCRAR
FT                   NGIPEVASRLLNVTPTSKFEDNLVAPDREVVFPLDIGIVGWVAHVKKALNVSDVKKNSH
FT                   FSDFMDKQTGYVTRNLLAVPIVAGKEVLAVVMAVNKISAPEFSKQDEEVFSKYLSFVAV
FT                   ALRLQHTSYLYSVESRRSQILMWSANKVFEELTDVERQFHKALYTIRTYLNCDRYSIGL
FT                   LDMTKEKEFYDEWPIKLGEVEPYKGPKTPDGREIIFYKIIDYILHGKEEINVIPSPPAD
FT                   HWTLVSGLPTYVAENGFICNMLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNKKEDI
FT                   VGVATFYNRKDGKPFDEHDEHITETLTQFLGWSLLNTDTYERVNKLESRKDIAQEMVMN
FT                   LTKATPDEISSILKFKEKLNVEVIEECEERQLLAILKEDLPDPRTADLYEFCFSDFPIT
FT                   EHELVKCGLRLFLEINVVEKFKVPVEVLTRWMYTVRKGYRPVTYHNWRHGFNVGQTMFT
FT                   LLMTGRLKKYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMKSTSPLARLHGTSILERHHL
FT                   EYSKTLLQDESLNIFQNLNKRQFETVIHLFEVAIIATDLALYFKKRTMFQKIVDTCEQM
FT                   QSEEETIKYVTSDPTKKEVIMAMMMTACDLSAITKPWEVQSQPMMDRSKKDELPKLQVG
FT                   FIDFVCTFVYKEFSRFHGEITPMLNGLQNNRVEWKSLAEEYEAKVKVTEEEAGKQEEEA
FT                   SDGKAATDLGGSAEDKKSKTCLML"
FT   misc_difference 2893..2901
FT                   /gene="Pde6c"
FT                   /note="polyA tail: 9 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2901 BP; 863 A; 640 C; 730 G; 668 T; 0 other;
     catacaggca gcttggagga actactaaac aaccttcctg cttcacatag ccacctgggg        60
     cttccttggc gattttgacc aggatgtatt tccttggtat ggtgctcagg gtatcactct       120
     gagaaaccct ccactctggg tagcagcagc aacacaagcc acagcatggg tgagatcagc       180
     caagaggccg tggagcgcta cctggagaag aacccttgtt ttgccaaaga gtattttgac       240
     aagaaactac gggtggaggc actgggggtg atcttcaaaa acagccatgc aggggtccag       300
     accggcttgt cgctccctga gatgacacag gtggaggagt cggccgtgtg cctggagcta       360
     ctgcagtgta tgcaggacga ggccggaagc gcggagcaga tggctcaccg ggcactgcag       420
     aggctcgctc aacttctgca ggctgattgc tgcagtatgt tctcgtgcag agcaagaaac       480
     ggcataccag aggtggcctc caggctgctg aacgtcaccc caacttctaa gtttgaggac       540
     aacctcgtgg cccctgacag agaagttgta tttccgttgg acattgggat agttggctgg       600
     gtcgctcatg tgaagaaagc ccttaatgtc tcagatgtca aaaagaacag ccatttttct       660
     gactttatgg acaagcaaac tggatatgtc accaggaatc tgctagcagt cccgatcgtg       720
     gcaggcaagg aggtccttgc tgtggtcatg gcagtgaaca aaatcagcgc tcccgagttt       780
     tccaaacagg atgaggaggt cttttctaag tacctcagct ttgttgctgt cgcactaagg       840
     ctgcagcaca ccagttacct gtacagtgtg gagtcccgga gaagccagat ccttatgtgg       900
     tcagccaata aagtattcga agagctcact gatgttgagc gacagtttca caaggcactg       960
     tacaccatca ggacgtacct gaactgcgat cgctactcca ttggtcttct ggacatgacc      1020
     aaggagaagg aattttacga tgagtggcca atcaagcttg gagaagttga gccttataaa      1080
     ggaccaaaga ctccagatgg cagggaaatc atcttctata aaatcatcga ttacatttta      1140
     catggaaaag aagagatcaa cgtgattccg tcacctccag cagaccactg gacgcttgtt      1200
     agtggattgc caacatacgt tgcagaaaat ggatttatct gtaacatgct gaatgcccct      1260
     gcagatgagt acttcacatt tcagaaagga ccggtagatg agactggctg ggtcattaaa      1320
     aatgtcttgt ccctgcctat tgtcaacaag aaagaagaca tcgtgggtgt agctacgttt      1380
     tacaaccgga aggatgggaa accctttgat gagcatgatg aacatatcac tgagacttta      1440
     acccagtttc ttggatggtc tcttttaaac accgatacct atgagcgagt gaacaagctg      1500
     gaaagcagaa aggacattgc tcaggaaatg gttatgaacc tcacaaaagc caccccggat      1560
     gaaatcagct ctattctgaa gtttaaagag aagttaaatg tagaggtaat tgaagagtgt      1620
     gaagagagac agctcctggc catattgaag gaggacttgc cggacccgag aacagcagac      1680
     ctgtacgagt tctgtttcag cgacttcccc attacggagc acgagttggt taaatgcggg      1740
     ctgaggctgt ttttggagat aaacgtggtg gagaaattca aagtccctgt agaggttctt      1800
     acaaggtgga tgtacacagt ccggaaaggg taccgtcctg tcacctacca caactggcgg      1860
     cacggattca acgtggggca gaccatgttc actttgttaa tgacaggaag actaaagaaa      1920
     tactatacag accttgaagc ctttgccatg ctcgctgctg ctttctgcca tgacattgac      1980
     cacagaggca ccaataactt gtaccaaatg aagtccacat ctccacttgc aaggcttcat      2040
     gggacttcca ttttagagcg acatcacctg gaatatagca agactctctt gcaggatgag      2100
     agtttaaaca tcttccagaa tctaaacaag cggcagtttg aaacggtgat ccatttgttc      2160
     gaggttgcaa taatagcaac tgacctggca ctctatttca agaagagaac catgtttcaa      2220
     aagatcgttg atacctgcga gcagatgcaa agtgaagaag aaaccatcaa atacgtaacc      2280
     tccgacccga ccaaaaagga agtcatcatg gccatgatga tgactgcctg tgacctgtct      2340
     gccatcacca agccctggga ggtgcagagt cagcctatga tggacagaag caaaaaggat      2400
     gaactcccga aacttcaagt gggatttatt gattttgttt gtactttcgt atataaggag      2460
     ttctctcggt ttcatggaga gatcacaccc atgctgaacg gccttcagaa taacagggtg      2520
     gaatggaaat ccctggcgga ggagtacgag gcgaaggtga aggtgactga agaagaggcg      2580
     ggaaagcagg aagaagaagc ctcagatgga aaagctgcca cagatttagg aggcagcgcc      2640
     gaagacaaaa agtccaaaac atgcttaatg ttataatcta actggtctgt atttcaagta      2700
     tcatcttagt ttccacgaaa aaaaaacatc caaaagagcc tccttgattg agttctgtcc      2760
     agtgaccaag aagtgacaga agaggaagag ccccagagat tctgccatgt gactacccac      2820
     agattatcca ttgctgacct ggaaaccctg tgagctaaat aaagtttagt aaaaacaaaa      2880
     catgacaaaa aaaaaaaaaa a                                                2901
//