spacer

EBI Dbfetch

ID   BC026854; SV 1; linear; mRNA; STD; MUS; 2171 BP.
XX
AC   BC026854;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus spinster homolog 1 (Drosophila), mRNA (cDNA clone MGC:28700
DE   IMAGE:4242049), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2171
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2171
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a557e9f3db1977aab7539a6c4c07ca89.
DR   Ensembl-Gn; ENSMUSG00000030741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032994; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 37 Row: n Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Similarity but not
CC   identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2171
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:28700 IMAGE:4242049"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2171
FT                   /gene="Spns1"
FT                   /note="synonyms: Spin1, Spinl"
FT   CDS             319..1905
FT                   /codon_start=1
FT                   /gene="Spns1"
FT                   /product="spinster homolog 1 (Drosophila)"
FT                   /db_xref="GOA:Q8R0G7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:1920908"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R0G7"
FT                   /protein_id="AAH26854.1"
FT                   /translation="MAGSDTAPFLSQADDPDDGPAPGHPGLPGPMGNPKSGELEVPDCE
FT                   GLQRITGLSRGHSTLIVVVLCYINLLNYMDRFTVAGVLTDIEQFFNIGDGSTGLIQTVF
FT                   ISSYMVLAPVFGYLGDRYNRKYLMCGGIAFWSLVTLGSSFIPREHFWLLLLTRGLVGVG
FT                   EASYSTIAPTLIADLFVADQRSRMLSIFYFAIPVGSGLGYIAGSKVKDVAGDWHWALRV
FT                   TPGLGVLAVLLLFLVVQEPPRGAVERHSGSPPLSPTSWWADLKALARNPSFVLSSLGFT
FT                   SVAFVTGSLALWAPAFLLRSRVVLGETPPCLPGDSCSSSDSLIFGLITCLTGVLGVGLG
FT                   VEISRRLRRFNPRADPLVCAAGLLGSAPFLFLALACARGSIVATYIFIFIGETLLSMNW
FT                   AIVADILLYVVIPTRRSTAEAFQIVLSHLLGDAGSPYLIGLISDRLRRSWPPSFLSEFR
FT                   ALQFSLMLCAFVGALGGAAFLGTAMFIEDDRRRAQLHVQGLLHESGPSDDRIVVPQRGR
FT                   STRVPVSSVLI"
FT   misc_difference 2158..2171
FT                   /gene="Spns1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2171 BP; 372 A; 652 C; 634 G; 513 T; 0 other;
     gcagttgtgt tgctgagctt ggactgagca acagcgagtg tggcgcgctc cttcccgggc        60
     tttggagtgc gtcagcgtga gaagagggac tgggtcctgg tcttcctgct cctgtcccag       120
     cgtcacctgc acctcctgtg tgctctcctc tgtcggaacc agagggaatg acgaagccca       180
     gggcttttcg cagtggtgca ctgtgcatcg gaccacgctc ctaggcgata gtgggcaagt       240
     cttctcgcag tcctctctcc aacctccttc cgtcggaggt aggaccgaag cgtgggcggt       300
     tgcgattccc cagggaccat ggccgggtcc gacacggcgc ccttcctcag ccaagcagat       360
     gatcctgatg acgggccagc gcccggccat ccggggttgc caggacccat ggggaatcca       420
     aagtccgggg aactcgaggt cccagactgt gaggggctac agcgcatcac tggcttatct       480
     cggggccatt cgaccctcat agtggtggtt ctgtgctaca ttaacctcct gaactacatg       540
     gaccgcttca ccgtggcagg ggttcttaca gacatcgagc agttctttaa catcggagat       600
     ggtagtactg gcctcatcca gactgtgttc atctccagtt acatggtgtt ggcaccagtg       660
     tttggctacc tgggtgacag gtacaatcga aagtacctca tgtgcggggg cattgccttc       720
     tggtccctgg tgacactggg atcatccttc atccccagag agcatttctg gctgcttctc       780
     ctgacccggg gcctggtggg ggtcggggag gccagttact ccaccattgc gcccaccctg       840
     atcgccgacc tcttcgtggc agaccagcgg agtcggatgc tcagtatctt ctactttgcc       900
     atccctgtgg gcagtggtct aggttacatt gctggctcca aagtgaaaga cgtggctgga       960
     gactggcact gggctctacg ggtgacacca ggtctaggag tgctggctgt cctgctgctg      1020
     ttcctggtgg tccaggagcc cccaagagga gccgtggagc gccactcagg ttcaccaccc      1080
     ctgagcccca cctcttggtg ggcagatctg aaggcactgg cacgaaatcc tagtttcgtc      1140
     ctgtcttccc ttggcttcac ctctgtggcc tttgtcacgg gctccctggc tctctgggcc      1200
     ccagcgttcc tgctgcgctc ccgggttgtt ctgggagaga ctccgccctg tctccctgga      1260
     gattcatgct cttcctctga cagtctcatc tttggactca tcacttgcct gactggagtc      1320
     ctgggtgtgg gcctgggagt ggagatcagc cgccgccttc gccgcttcaa ccctcgggct      1380
     gacccactcg tctgtgcagc tggcctcctg ggttcggcgc ctttcctctt cctggccctg      1440
     gcctgtgccc gaggtagcat cgtggccacc tatattttta tctttattgg ggagaccctg      1500
     ttgtccatga actgggccat tgtggctgac atcctgttgt acgtggtgat cccaactcga      1560
     cggtccacgg ctgaggcctt ccagatagtg ctgtcccact tgctaggaga tgcagggagc      1620
     ccttacctca ttggtctaat ctctgaccgc ctccgacgga gctggccccc ttccttcctg      1680
     tccgagttcc gggctctgca gttctcgctc atgctctgtg ctttcgttgg ggcactgggt      1740
     ggtgcggcct tcctgggcac cgccatgttc attgaagatg accgccggcg ggctcaactc      1800
     cacgtgcagg gtctgttgca tgagtctggg ccctcagatg accggattgt agtacctcag      1860
     cgaggccgtt ctacccgagt ccccgtgtcc agcgtgctca tctgaggagc cggtgcttac      1920
     ccggccactg atgcatcgca gctgggcctt gggcccaccc aagacggttc ccaggcagaa      1980
     gccctcacca ggcccaggtc caagaaggaa gccctgggat atctcccagc tcccagacac      2040
     tacatgggca gcccagggaa gagatgggag tccagaaacg gggaaggggt gtcctctcta      2100
     ctaggacagc ccaaggggtt tggtgctatt tgtaatggaa taaaatttgt aatcagaaaa      2160
     aaaaaaaaaa a                                                           2171
//


spacer
spacer