spacer

EBI Dbfetch

ID   BC026418; SV 1; linear; mRNA; STD; MUS; 2126 BP.
XX
AC   BC026418;
XX
DT   09-APR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 3,
DE   mRNA (cDNA clone MGC:31283 IMAGE:4218953), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2126
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2126
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (02-APR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; eaeb6be58817b60796db9ebb70ea736d.
DR   Ensembl-Gn; ENSMUSG00000031803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034260; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 43 Row: j Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982624.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2126
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:31283 IMAGE:4218953"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2126
FT                   /gene="B3gnt3"
FT   CDS             92..1210
FT                   /codon_start=1
FT                   /gene="B3gnt3"
FT                   /product="UDP-GlcNAc:betaGal
FT                   beta-1,3-N-acetylglucosaminyltransferase 3"
FT                   /db_xref="GOA:Q5JCS9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:2152535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5JCS9"
FT                   /protein_id="AAH26418.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPTLVMAEDRYPPYCGGGGFLLSRFTVA
FT                   ALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
FT   misc_difference 196
FT                   /gene="B3gnt3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 325
FT                   /gene="B3gnt3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 857
FT                   /gene="B3gnt3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'T' in cDNA, 'A' in the mouse genome."
FT   misc_difference 1015
FT                   /gene="B3gnt3"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1249
FT                   /gene="B3gnt3"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1259
FT                   /gene="B3gnt3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1330
FT                   /gene="B3gnt3"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 1512
FT                   /gene="B3gnt3"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1651
FT                   /gene="B3gnt3"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1656
FT                   /gene="B3gnt3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1816
FT                   /gene="B3gnt3"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 1818
FT                   /gene="B3gnt3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1959
FT                   /gene="B3gnt3"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2054..2055
FT                   /gene="B3gnt3"
FT                   /note="2 bases in cDNA are not found in the mouse genome."
FT   misc_difference 2059
FT                   /gene="B3gnt3"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2071
FT                   /gene="B3gnt3"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2098..2126
FT                   /gene="B3gnt3"
FT                   /note="polyA tail: 29 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2126 BP; 458 A; 645 C; 574 G; 449 T; 0 other;
     ggagcgggaa agggagaaca gggaagaagc ggaggaaggc gagtagccaa gagccagctc        60
     aaggcggtcg cccaggctcc gcccccacgc catgcggctg ccaaggcaga gcccctacga       120
     gatcctcctc ctggtcttgg tcgccttgct ggtgctgctg ctgctcctga ccagcaagtc       180
     accgcccagc tgctccgccc ctgagaggtc caaggagcct gaagacaacc ccgggtgggc       240
     cacgggccac ccacgcacac accccgcccg gtgccgagct aatctatccg tgtcctcgca       300
     ccccgacttc gcggggctgc ccttgcacgt gcgcgacttc ttgttctacc gccactgccg       360
     cgacttccca gtgctccgag agccgcgggt taccaagtgc gcggagcccg tgttcctgct       420
     gctcgccatc aagtcctcgc ctgcaaacta tgggcgccgc cagatgctgc gcacgacgtg       480
     ggcgcgcgag agacgggtgc gtggggcgcc actgcgccgc ctcttccttg tgggctcaga       540
     ccgcgaccca caacaagcac gcaaatacaa ccgactgctg gagctggaag cgcagaaata       600
     cggcgacatt ctccagtggg atttccatga ctccttcttt aacctgacgc ttaagcaggt       660
     ccttttcctg gagtggcagc taacctactg taccaacgcc agcttcgtgc tcaatgggga       720
     cgacgatgtg ttcgcacaca cggacaacat ggtcacctac ctgcaggacc acgacccgga       780
     ccaacacctc ttcgtggggc acctgatcca gaacgtgggt cccatccggg tgccctggag       840
     caagtacttc atccccactc tggtgatggc ggaggacaga tacccgccct actgtggtgg       900
     cggcggcttc ctgctgtcgc gttttaccgt ggccgcccta cgtcgcgccg cgcgcgtcct       960
     ccccatgttc ccaatcgacg acgtgttcct gggcatgtgt ctgcagcagc aggggctggc      1020
     tcccgggacg cacagcggag tgcgcactgc gggggttttc ccccctagcc cacgtgtgtc      1080
     atccttcgac ccctgcttct accgcgacct gctcctcgtg caccgcttcc tgcccttcga      1140
     gatgctgctg atgtgggatg cgctgaacca gccccagctc ctctgcggca ggcagagccc      1200
     cgcctactga gaggtttggg ggagttgaca tcccctagct catgtcctcc ctcatccatg      1260
     tgcaaagggc tggcttcaag gagaagttca aagtgagggg cagaaaggtg ggtctgagga      1320
     gttcatagga caaactccta agtacgcttg gaaaccctct tggtactgtt cacagcagga      1380
     actctgagtc tagccaactc tgagtggctc taagtggccg ctaagcaaaa actgctgtgg      1440
     acagagccca tgggttttag gctctgggcc ttggcctctc tcaggccccc aaggaattgg      1500
     gcagaggaac atggtggatt ttaaactgag gtgctcagag atcttgactt gacccccact      1560
     agtgtctccc aagaacttgg agaaccacag gggcaggagg ggtcctgtgt cccacagacc      1620
     gggctggcag gaaataaagt ccatagaagg atgaatgtga ttgtaggggg aaggttaaga      1680
     taaaactcag ggctctgcca cgttttaatt ttatctattt aggaagggag ccaggtcctg      1740
     tcttcctctc tgtttgggtc ctgggacttg aactcaaatc ttcaggcttg gcagcaagtg      1800
     cctccattaa ctgagccgtc tcgccagtgc ctttttagtt ttcagcacta ctcatgtttt      1860
     aacaccggct gctctacccc acctctcttt gaccttcaat attaactcat tgcaacatgt      1920
     tcacatctac agcatggctg tatgtggctc ctgcctcctc ttgctccctt ccctgtagct      1980
     actttgtggg ttctttttct tccaaaattg caacccctcc ccaacaccag acaggagaga      2040
     aaaaagtata gagaggaagg aaaagagatt ccccaataaa gtctcagcgc ttggaaaaaa      2100
     aaaaaaaaaa aaaaaaaaaa aaaaaa                                           2126
//


spacer
spacer