Dbfetch

ID   BC025932; SV 1; linear; mRNA; STD; MUS; 1950 BP.
XX
AC   BC025932;
XX
DT   24-MAR-2002 (Rel. 71, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus cysteine-rich with EGF-like domains 1, mRNA (cDNA clone
DE   MGC:36587 IMAGE:5102571), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1950
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1950
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; dfdc6422218c7dfdb5c51c759b3eb0c8.
DR   Ensembl-Gn; ENSMUSG00000030284; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000032422; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 57 Row: k Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 19527147.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1950
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:36587 IMAGE:5102571"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1950
FT                   /gene="Creld1"
FT   CDS             241..1503
FT                   /codon_start=1
FT                   /gene="Creld1"
FT                   /product="cysteine-rich with EGF-like domains 1"
FT                   /db_xref="GOA:Q91XD7"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR002049"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR021852"
FT                   /db_xref="MGI:MGI:2152539"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XD7"
FT                   /protein_id="AAH25932.1"
FT                   /translation="MAPLPPRGLVPSLLWCLSLFLSLPGPVWLQPSPPPHPSPRAEPHP
FT                   CHTCRALVDNFNKGLERTIRDNFGGGNTAWEEEKLSKYKDSETRLVEVLEGVCSRSDFE
FT                   CHRLLELSEELVENWWFHRQQEAPDLFQWLCSDSLKLCCPSGTFGPSCLPCPGGTERPC
FT                   GGYGQCEGEGTRGGSGHCDCQAGYGGEACGQCGLGYFEAERNSSHLVCSACFGPCARCT
FT                   GPEESHCLQCKKGWALHHLKCVDIDECGTEQATCGADQFCVNTEGSYECRDCAKACLGC
FT                   MGAGPGRCKKCSRGYQQVGSKCLDVDECETVVCPGENEKCENTEGGYRCVCAEGYRQED
FT                   GICVKEQVPESAGFFAEMTEDEMVVLQQMFFGVIICALATLAAKGDLVFTAIFIGAVAA
FT                   MTGYWLSERSDRVLEGFIKGR"
FT   misc_difference 1938..1950
FT                   /gene="Creld1"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1950 BP; 389 A; 551 C; 586 G; 424 T; 0 other;
     cgatcccggc cacctccccc tacggtaacg gagaaataat ttctctgctg gaatcgtaga        60
     ttaggctctt tcaccccttc cagcgcctct gcttccacta ccccagttta tcctcgtttt       120
     gtaattacgt aggtctgggg ctctgagccc caaggcgcct cgctttcctc ccttacagcc       180
     tggcttctcc agtgaaccct ccccctgccc tctatctgca cgtccccagc ctgggaaaag       240
     atggctccac tgcccccaag gggcctggtc ccatctctgc tctggtgctt gagcctgttt       300
     ctgagcctcc caggacctgt ctggctccaa ccctctcctc ctccccatcc ttctccccga       360
     gctgagcccc atccgtgtca tacctgccgg gcactggtgg acaacttcaa caagggcctg       420
     gagagaacca tccgggacaa cttcgggggt ggaaacacgg cctgggagga agagaagttg       480
     tccaaataca aagacagtga gacccgcctg gtggaggtgc tggagggcgt gtgcagcagg       540
     tcagacttcg agtgccaccg cctgctcgag ctgagcgagg agctggtgga aaactggtgg       600
     tttcacaggc agcaggaagc ccccgacctc ttccagtggc tctgttccga ttccctgaag       660
     ctctgctgcc cctctggcac ctttgggccc tcctgcctgc catgtcctgg gggcacagag       720
     aggccctgcg gtggctacgg gcagtgtgaa ggggaaggga ctcgaggggg cagcgggcac       780
     tgtgactgcc aagccggcta tgggggcgag gcctgtggcc agtgtggcct tggctacttt       840
     gaggcggagc gcaacagcag ccatctggta tgttcggcgt gttttggtcc ttgtgcccgc       900
     tgcacgggac ctgaggaatc ccattgtctg cagtgcaaga aaggctgggc cctgcatcac       960
     ctcaagtgtg tagacatcga tgagtgtggt acagagcaag ccacctgtgg agctgaccag      1020
     ttctgtgtga acacagaagg atcctacgag tgccgagact gtgcaaaggc ctgcctgggc      1080
     tgtatgggag cagggccagg gcgctgcaaa aagtgcagcc gtggctacca gcaggtgggc      1140
     tccaagtgcc tagatgtgga tgagtgtgag actgtggtgt gtccaggaga gaatgagaag      1200
     tgtgaaaaca cggagggagg ctaccgctgt gtctgtgctg agggctacag acaggaggac      1260
     ggcatctgcg tgaaggagca ggtcccggag tcggcgggct tctttgcgga gatgacggag      1320
     gatgaaatgg tggttctgca gcagatgttc tttggtgtaa tcatctgtgc gctggccacg      1380
     cttgctgcca agggtgactt ggtgttcact gccatcttca ttggagctgt ggcagccatg      1440
     actgggtact ggttgtcaga gcggagtgac cgtgtgctgg agggcttcat caagggtaga      1500
     taatccctgc cgccactcac aggatttcct cccacccagg ctgctcctag aggttatttc      1560
     tctctcccta tggatacctg ggacagcata gtttctcttt gagactgggg taaacaccct      1620
     tttacctgcc ttactgagca gcccaggacc ccagtggccc cagggggttg aaaaagaggt      1680
     cctgaagcag atgccacgag atcctagcct aggacactgg caggcctcac cgtgtatgaa      1740
     tcccaagaca gtttctcccc agggaggttg caggtgggct ttggcccctg acccggatga      1800
     gaggtgtccc ctcaggggtg ggcccccata ggccccttgc caggtgcatg ctgccagctc      1860
     cagctgtgta ttcaccgccc acgccctagc catcgactta tttattcatc tcaggaaata      1920
     aaggacggtc ttgaaaaaaa aaaaaaaaaa                                       1950
//