spacer

EBI Dbfetch

ID   BC025878; SV 1; linear; mRNA; STD; MUS; 1372 BP.
XX
AC   BC025878;
XX
DT   17-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus sirtuin 3 (silent mating type information regulation 2,
DE   homolog) 3 (S. cerevisiae), mRNA (cDNA clone MGC:30995 IMAGE:5253854),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1372
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1372
RA   Strausberg R.;
RT   ;
RL   Submitted (13-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; acfb6a255828f5bc0ce544f6d10de14b.
DR   Ensembl-Gn; ENSMUSG00000025486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026559; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106048; mus_musculus.
DR   EuropePMC; PMC2760358; 19241369.
DR   EuropePMC; PMC3558747; 20677216.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 45 Row: p Column: 5
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 11967962.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1372
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:30995 IMAGE:5253854"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1372
FT                   /gene="Sirt3"
FT   CDS             194..967
FT                   /codon_start=1
FT                   /gene="Sirt3"
FT                   /product="Sirt3 protein"
FT                   /db_xref="GOA:Q8R104"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR017328"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="MGI:MGI:1927665"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R104"
FT                   /protein_id="AAH25878.1"
FT                   /translation="MVGAGISTPSGIPDFRSPGSGLYSNLQQYDIPYPEAIFELGFFFH
FT                   NPKPFFMLAKELYPGHYRPNVTHYFLRLLHDKELLLRLYTQNIDGLERASGIPASKLVE
FT                   AHGTFVTATCTVCRRSFPGEDIWADVMADRVPRCPVCTGVVKPDIVFFGEQLPARFLLH
FT                   MADFALADLLLILGTSLEVEPFASLSEAVQKSVPRLLINRDLVGPFVLSPRRKDVVQLG
FT                   DVVHGVERLVDLLGWTQELLDLMQRERGKLDGQDR"
FT   misc_feature    194..805
FT                   /gene="Sirt3"
FT                   /note="sir2; Region: Catalytic domain of the SIR2 like
FT                   Histonde deacetylases and ADP ribosyl transferase"
XX
SQ   Sequence 1372 BP; 310 A; 358 C; 390 G; 314 T; 0 other;
     cgctaagcgg tcgactggca ttggccgcgc tcagactgtg gggtccggga gtgttacagg        60
     tgggagaagg cccatatccc tctgtgtggg agcctcaggc ggctttggag gtggaggaag       120
     cagtgagaag aagttttctc tgcaggatgt agctgagctg cttcggacca gagcctgcag       180
     tagggtggtg gtcatggtgg gggccggcat cagcacaccc agtggcatcc cggacttcag       240
     atccccaggg agcggcctct acagcaacct tcagcagtat gacatcccgt accctgaagc       300
     catctttgaa cttggctttt tctttcacaa ccccaagccc tttttcatgt tggccaagga       360
     gctgtaccct gggcactaca ggcccaatgt cactcactac ttcctgaggc tcctccacga       420
     caaggagctg cttctgcggc tctatacaca gaacatcgac gggcttgaga gagcatctgg       480
     gatccctgcc tcaaagctgg ttgaagccca cgggaccttt gtaacagcta catgcacggt       540
     ctgtcgaagg tccttcccag gggaagacat atgggctgat gtgatggcgg acagggtgcc       600
     ccgctgccct gtctgtactg gcgttgtgaa acccgacatt gtgttctttg gggagcagct       660
     gcctgcaagg ttcctactcc atatggctga cttcgctttg gcagatctgc tactcattct       720
     tgggacctcc ctggaggtgg agccttttgc cagcttgtct gaagcagtac agaaatcagt       780
     gccccgactg ctcatcaatc gagacttggt ggggccgttc gttctgagtc ctcgaaggaa       840
     agatgtggtc cagctagggg atgtagttca tggtgtggaa aggctggtgg acctcctggg       900
     gtggacacaa gaactgctgg atcttatgca gcgggaacgt ggcaagctgg atggacagga       960
     cagataagac tatggcttct tcacctgggg aagtcacaca gcagatcatc ctatgtccag      1020
     caagacttca tgcctgaaga cagctccaac acgtttacaa acatgaacca gaccacaaca      1080
     tgtggcctgg acagtggtcc tccgaggctg cctttggaaa ggctgaccag ggatgtctac      1140
     ccttggggcc cctccatgtg tgcgccctgt ccacctcatc actgctgaag gtgtagtgca      1200
     ggtgctgctt tctgcagcgg cccttaagtt atcacgaggg cagcacagca cgcccgtcgc      1260
     caggcaggcg atgcactagg gcaatctagc atgttgatcg gtaaagtggc atctttaact      1320
     acaacatcat ttcttgcatg aaataaactt agtataaaaa aaaaaaaaaa aa              1372
//


spacer
spacer