spacer

EBI Dbfetch

ID   BC025811; SV 1; linear; mRNA; STD; MUS; 3648 BP.
XX
AC   BC025811;
XX
DT   15-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:37763 IMAGE:5096872), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3648
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3648
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d4087b99534a6e49f49a7e24ed2f0d99.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 57 Row: b Column: 4.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3648
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:37763 IMAGE:5096872"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3648
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   CDS             231..3302
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH25811.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3636..3648
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3648 BP; 857 A; 972 C; 1006 G; 813 T; 0 other;
     ggcgcggagc ctcggcggga ggaggcggac acgtggcagc ggcggcagca gcggcggcag        60
     cagcggcggc ctcggtccgg ggcgccggcc gtcctccctc tttcctcccg cggcagccct       120
     agttcccgcc tctcggctcc cccggctccg ctctcccggc cgggagctgc tctcttctct       180
     ttctagtctc cagcaacagg acccggcgcg gggcccgcag cgccgccacc atggggaagg       240
     gggttggacg agacaagtat gagcctgccg ctgtatcgga gcatggtgac aaaaagggca       300
     aaaaggccaa gaaggaaagg gatatggatg agctcaagaa ggaagtgtct atggacgacc       360
     ataaactcag cctggatgaa ctccatcgta aatacggaac agatttgagc cgaggattaa       420
     cacctgcaag ggccgctgag atcctggccc gggatggccc caacgccctc acaccccctc       480
     ccactactcc cgaatgggtg aaattctgcc ggcagctctt tggaggcttt tccatgttac       540
     tgtggatcgg ggccattctt tgtttcctgg cttatggcat ccgaagtgct acagaagagg       600
     aaccgccaaa cgatgatctg tacctcgggg tggtgctctc tgctgtagtc atcataactg       660
     gctgtttctc ctattatcaa gaagcaaaaa gctccaagat catggaatcc ttcaagaaca       720
     tggtccctca gcaagccctt gtgattcgaa atggagagaa aatgagcatc aatgcggagg       780
     atgtcgtcgt cggggatctg gtggaggtga aagggggaga ccggatccct gctgatctta       840
     gaatcatatc tgcaaacggc tgcaaggtgg ataactcctc actcactggt gaatcagaac       900
     cccagactcg gtccccggat ttcacaaacg agaacccctt ggagacaagg aacattgcct       960
     tcttctcaac caactgtgtg gaaggaaccg cacgtggcat cgtcgtgtac actggggacc      1020
     gcaccgtgat gggcaggatt gccacgcttg cctctgggct agaaggtggc cagaccccca      1080
     ttgctgaaga gattgagcat ttcatccacc tcatcaccgg ggtggccgtg ttcctggggg      1140
     tgtctttctt catcctttct ctgatccttg agtacacctg gctcgaggct gtcatcttcc      1200
     tcattggtat catcgtagcc aacgtgccag aaggtctgct ggccactgtc acggtctgtc      1260
     tgacactcac tgccaagcgc atggcgagga agaactgcct ggtgaagaac ttggaagctg      1320
     tggagacctt ggggtccaca tctaccatct gctcagacaa gacgggaact ctgactcaga      1380
     accggatgac agtggcccac atgtggtttg acaatcagat ccatgaagct gacaccacgg      1440
     agaatcagag tggtgtctcc tttgacaaga cgtcagccac ctggttcgct ctgtccagaa      1500
     ttgctggtct ctgtaacagg gcagtgtttc aggctaacca agaaaacctg cctattctta      1560
     agcgggcagt agcgggagat gcctctgagt cggcgctctt aaagtgcatt gaagtctgct      1620
     gcggctccgt gatggagatg agggagaaat acagcaagat agtggagatt cccttcaact      1680
     ccaccaacaa gtaccagttg tccattcaca agaacccaaa tgcatctgag cccaaacacc      1740
     tgctagtgat gaagggcgcc ccagaaagga tcctggaccg ctgcagctcc atccttctcc      1800
     acggcaagga gcagccactg gatgaagagc tgaaggacgc ttttcagaac gcctacctag      1860
     agctgggggg ccttggagaa cgtgtgctag gtttctgcca cctcctcctg cctgacgaac      1920
     agtttcccga aggcttccag tttgacactg acgatgtcaa tttccccgtg gataacctct      1980
     gcttcgtggg tcttatctcc atgattgacc ctccccgagc tgctgtcccc gatgctgtgg      2040
     gcaaatgccg cagcgctggg attaaggtca tcatggttac aggagaccat ccaatcacag      2100
     cgaaagccat tgccaagggg gtaggcatta tctcagaagg caatgagact gtggaagaca      2160
     ttgctgcccg cctcaacatt ccagtgaacc aggtgaaccc cagagatgcc aaggcctgtg      2220
     tggtccacgg cagtgacctg aaggacatga cctccgagga gctggatgac atcttgcggt      2280
     accacacaga gatcgtcttt gccaggacct ctcctcagca gaagctcatc attgtggagg      2340
     gctgccagcg gcagggcgcc atcgtggccg tcacagggga tggtgtcaat gactctccag      2400
     ctttgaaaaa ggcagatatt ggggttgcca tggggattgt tggctctgat gtgtccaagc      2460
     aagctgctga catgatcctt ctggatgaca actttgcctc cattgtgact ggagtagagg      2520
     aaggtcgtct gatttttgat aacttgaaga aatccatcgc ttacacccta accagtaaca      2580
     ttccggaaat cacccccttc ttgatattta ttattgcaaa cattccactg cccctgggga      2640
     ctgtgaccat cctctgcatt gacttgggca ctgacatggt tcctgccatc tccctggcct      2700
     acgagcaagc tgagagcgac atcatgaaga ggcagcccag aaaccccaaa acggacaaac      2760
     ttgtgaacga gcgtctgatc agcatggcct atggacagat cggtatgatc caggccctgg      2820
     gaggcttctt cacttacttt gtgattctgg ctgagaacgg tttcctgccc tttcacctgt      2880
     tgggcatccg agagacctgg gatgaccgct gggtcaacga tgtggaggac agctacgggc      2940
     agcagtggac ctacgagcag aggaagatcg tggagttcac ctgccataca gcgttctttg      3000
     tcagtattgt ggtagtgcag tgggccgact tggtcatctg caagaccaga aggaattctg      3060
     tcttccagca gggaatgaag aacaagatct tgatatttgg cctctttgaa gagacagccc      3120
     ttgctgcttt cttatcctac tgccccggga tgggggcagc ccttaggatg tatcccctca      3180
     aacctacatg gtggttctgt gccttcccct actcccttct catctttgtg tatgacgagg      3240
     tgcggaagct cattatcagg cggcgccctg gcggctgggt ggagaaggaa acctactact      3300
     agcccactgc cctgcacgcc gtggaacatt gtgccacaca ctgcacccac ccctaccccc      3360
     tctttgtgta cttcaagtct tggagctcgg aactctaccc tggtaggaaa gcaccaaagc      3420
     atgtggggat gcagacgtcc tggaatgaag catgtagctg taacgggggg cggggcgggg      3480
     gggagggctg cctgagaaac accgtgtacg gggacgacag cgggcaaggt ttatacgtgc      3540
     ctttttgttt ttgtaaaaaa ggaaaacctg gaaagactga aagattacgt tttatatctg      3600
     gatttttaca aataaagatg gctattataa cggaaaaaaa aaaaaaaa                   3648
//


spacer
spacer