spacer

EBI Dbfetch

ID   BC025627; SV 1; linear; mRNA; STD; MUS; 3670 BP.
XX
AC   BC025627;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:38117 IMAGE:5320513), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3670
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3670
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 1643ded43be4ace2cd4201dcda9c1e55.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: f Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3670
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38117 IMAGE:5320513"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3670
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   misc_difference 1..9
FT                   /gene="Atp1a1"
FT                   /note="9 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 11
FT                   /gene="Atp1a1"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   CDS             244..3315
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH25627.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3646..3670
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 25 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3670 BP; 868 A; 978 C; 1010 G; 814 T; 0 other;
     ccacgcgtcc gggggcgcgg agcctcggcg ggaggaggcg gacacgtggc agcggcggca        60
     gcagcggcgg cagcagcggc ggcctcggtc cggggcgccg gccgtcctcc ctctttcctc       120
     ccgcggcagc cctagttccc gcctctcggc tcccccggct ccgctctccc ggccgggagc       180
     tgctctcttc tctttctagt ctccagcaac aggacccggc gcggggcccg cagcgccgcc       240
     accatgggga agggggttgg acgagacaag tatgagcctg ccgctgtatc ggagcatggt       300
     gacaaaaagg gcaaaaaggc caagaaggaa agggatatgg atgagctcaa gaaggaagtg       360
     tctatggacg accataaact cagcctggat gaactccatc gtaaatacgg aacagatttg       420
     agccgaggat taacacctgc aagggccgct gagatcctgg cccgggatgg ccccaacgcc       480
     ctcacacccc ctcccactac tcccgaatgg gtgaaattct gccggcagct ctttggaggc       540
     ttttccatgt tactgtggat cggggccatt ctttgtttcc tggcttatgg catccgaagt       600
     gctacagaag aggaaccgcc aaacgatgat ctgtacctcg gggtggtgct ctctgctgta       660
     gtcatcataa ctggctgttt ctcctattat caagaagcaa aaagctccaa gatcatggaa       720
     tccttcaaga acatggtccc tcagcaagcc cttgtgattc gaaatggaga gaaaatgagc       780
     atcaatgcgg aggatgtcgt cgtcggggat ctggtggagg tgaaaggggg agaccggatc       840
     cctgctgatc ttagaatcat atctgcaaac ggctgcaagg tggataactc ctcactcact       900
     ggtgaatcag aaccccagac tcggtccccg gatttcacaa acgagaaccc cttggagaca       960
     aggaacattg ccttcttctc aaccaactgt gtggaaggaa ccgcacgtgg catcgtcgtg      1020
     tacactgggg accgcaccgt gatgggcagg attgccacgc ttgcctctgg gctagaaggt      1080
     ggccagaccc ccattgctga agagattgag catttcatcc acctcatcac cggggtggcc      1140
     gtgttcctgg gggtgtcttt cttcatcctt tctctgatcc ttgagtacac ctggctcgag      1200
     gctgtcatct tcctcattgg tatcatcgta gccaacgtgc cagaaggtct gctggccact      1260
     gtcacggtct gtctgacact cactgccaag cgcatggcga ggaagaactg cctggtgaag      1320
     aacttggaag ctgtggagac cttggggtcc acatctacca tctgctcaga caagacggga      1380
     actctgactc agaaccggat gacagtggcc cacatgtggt ttgacaatca gatccatgaa      1440
     gctgacacca cggagaatca gagtggtgtc tcctttgaca agacgtcagc cacctggttc      1500
     gctctgtcca gaattgctgg tctctgtaac agggcagtgt ttcaggctaa ccaagaaaac      1560
     ctgcctattc ttaagcgggc agtagcggga gatgcctctg agtcggcgct cttaaagtgc      1620
     attgaagtct gctgcggctc cgtgatggag atgagggaga aatacagcaa gatagtggag      1680
     attcccttca actccaccaa caagtaccag ttgtccattc acaagaaccc aaatgcatct      1740
     gagcccaaac acctgctagt gatgaagggc gccccagaaa ggatcctgga ccgctgcagc      1800
     tccatccttc tccacggcaa ggagcagcca ctggatgaag agctgaagga cgcttttcag      1860
     aacgcctacc tagagctggg gggccttgga gaacgtgtgc taggtttctg ccacctcctc      1920
     ctgcctgacg aacagtttcc cgaaggcttc cagtttgaca ctgacgatgt caatttcccc      1980
     gtggataacc tctgcttcgt gggtcttatc tccatgattg accctccccg agctgctgtc      2040
     cccgatgctg tgggcaaatg ccgcagcgct gggattaagg tcatcatggt tacaggagac      2100
     catccaatca cagcgaaagc cattgccaag ggggtaggca ttatctcaga aggcaatgag      2160
     actgtggaag acattgctgc ccgcctcaac attccagtga accaggtgaa ccccagagat      2220
     gccaaggcct gtgtggtcca cggcagtgac ctgaaggaca tgacctccga ggagctggat      2280
     gacatcttgc ggtaccacac agagatcgtc tttgccagga cctctcctca gcagaagctc      2340
     atcattgtgg agggctgcca gcggcagggc gccatcgtgg ccgtcacagg ggatggtgtc      2400
     aatgactctc cagctttgaa aaaggcagat attggggttg ccatggggat tgttggctct      2460
     gatgtgtcca agcaagctgc tgacatgatc cttctggatg acaactttgc ctccattgtg      2520
     actggagtag aggaaggtcg tctgattttt gataacttga agaaatccat cgcttacacc      2580
     ctaaccagta acattccgga aatcaccccc ttcttgatat ttattattgc aaacattcca      2640
     ctgcccctgg ggactgtgac catcctctgc attgacttgg gcactgacat ggttcctgcc      2700
     atctccctgg cctacgagca agctgagagc gacatcatga agaggcagcc cagaaacccc      2760
     aaaacggaca aacttgtgaa cgagcgtctg atcagcatgg cctatggaca gatcggtatg      2820
     atccaggccc tgggaggctt cttcacttac tttgtgattc tggctgagaa cggtttcctg      2880
     ccctttcacc tgttgggcat ccgagagacc tgggatgacc gctgggtcaa cgatgtggag      2940
     gacagctacg ggcagcagtg gacctacgag cagaggaaga tcgtggagtt cacctgccat      3000
     acagcgttct ttgtcagtat tgtggtagtg cagtgggccg acttggtcat ctgcaagacc      3060
     agaaggaatt ctgtcttcca gcagggaatg aagaacaaga tcttgatatt tggcctcttt      3120
     gaagagacag cccttgctgc tttcttatcc tactgccccg ggatgggggc agcccttagg      3180
     atgtatcccc tcaaacctac atggtggttc tgtgccttcc cctactccct tctcatcttt      3240
     gtgtatgacg aggtgcggaa gctcattatc aggcggcgcc ctggcggctg ggtggagaag      3300
     gaaacctact actagcccac tgccctgcac gccgtggaac attgtgccac acactgcacc      3360
     cacccctacc ccctctttgt gtacttcaag tcttggagct cggaactcta ccctggtagg      3420
     aaagcaccaa agcatgtggg gatgcagacg tcctggaatg aagcatgtag ctgtaacggg      3480
     gggcggggcg ggggggaggg ctgcctgaga aacaccgtgt acggggacga cagcgggcaa      3540
     ggtttatacg tgcctttttg tttttgtaaa aaaggaaaac ctggaaagac tgaaagatta      3600
     cgttttatat ctggattttt acaaataaag atggctatta taacgaaaaa aaaaaaaaaa      3660
     aaaaaaaaaa                                                             3670
//


spacer
spacer