spacer

EBI Dbfetch

ID   BC025618; SV 1; linear; mRNA; STD; MUS; 3686 BP.
XX
AC   BC025618;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:38134 IMAGE:5320976), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3686
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3686
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 766935781e61e10429fd82a73d42d414.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
DR   EuropePMC; PMC2660260; 19144862.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: f Column: 2
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3686
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38134 IMAGE:5320976"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3686
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   misc_difference 1..6
FT                   /gene="Atp1a1"
FT                   /note="6 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 7
FT                   /gene="Atp1a1"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 9
FT                   /gene="Atp1a1"
FT                   /note="'C' in cDNA is 'G' in the mouse genome."
FT   CDS             253..3324
FT                   /codon_start=1
FT                   /gene="Atp1a1"
FT                   /product="ATPase, Na+/K+ transporting, alpha 1 polypeptide"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH25618.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_difference 3658..3686
FT                   /gene="Atp1a1"
FT                   /note="polyA tail: 29 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3686 BP; 874 A; 980 C; 1015 G; 817 T; 0 other;
     ccacgcgtcc ggctgggtct ggggcgcgga gcctcggcgg gaggaggcgg acacgtggca        60
     gcggcggcag cagcggcggc agcagcggcg gcctcggtcc ggggcgccgg ccgtcctccc       120
     tctttcctcc cgcggcagcc ctagttcccg cctctcggct cccccggctc cgctctcccg       180
     gccgggagct gctctcttct ctttctagtc tccagcaaca ggacccggcg cggggcccgc       240
     agcgccgcca ccatggggaa gggggttgga cgagacaagt atgagcctgc cgctgtatcg       300
     gagcatggtg acaaaaaggg caaaaaggcc aagaaggaaa gggatatgga tgagctcaag       360
     aaggaagtgt ctatggacga ccataaactc agcctggatg aactccatcg taaatacgga       420
     acagatttga gccgaggatt aacacctgca agggccgctg agatcctggc ccgggatggc       480
     cccaacgccc tcacaccccc tcccactact cccgaatggg tgaaattctg ccggcagctc       540
     tttggaggct tttccatgtt actgtggatc ggggccattc tttgtttcct ggcttatggc       600
     atccgaagtg ctacagaaga ggaaccgcca aacgatgatc tgtacctcgg ggtggtgctc       660
     tctgctgtag tcatcataac tggctgtttc tcctattatc aagaagcaaa aagctccaag       720
     atcatggaat ccttcaagaa catggtccct cagcaagccc ttgtgattcg aaatggagag       780
     aaaatgagca tcaatgcgga ggatgtcgtc gtcggggatc tggtggaggt gaaaggggga       840
     gaccggatcc ctgctgatct tagaatcata tctgcaaacg gctgcaaggt ggataactcc       900
     tcactcactg gtgaatcaga accccagact cggtccccgg atttcacaaa cgagaacccc       960
     ttggagacaa ggaacattgc cttcttctca accaactgtg tggaaggaac cgcacgtggc      1020
     atcgtcgtgt acactgggga ccgcaccgtg atgggcagga ttgccacgct tgcctctggg      1080
     ctagaaggtg gccagacccc cattgctgaa gagattgagc atttcatcca cctcatcacc      1140
     ggggtggccg tgttcctggg ggtgtctttc ttcatccttt ctctgatcct tgagtacacc      1200
     tggctcgagg ctgtcatctt cctcattggt atcatcgtag ccaacgtgcc agaaggtctg      1260
     ctggccactg tcacggtctg tctgacactc actgccaagc gcatggcgag gaagaactgc      1320
     ctggtgaaga acttggaagc tgtggagacc ttggggtcca catctaccat ctgctcagac      1380
     aagacgggaa ctctgactca gaaccggatg acagtggccc acatgtggtt tgacaatcag      1440
     atccatgaag ctgacaccac ggagaatcag agtggtgtct cctttgacaa gacgtcagcc      1500
     acctggttcg ctctgtccag aattgctggt ctctgtaaca gggcagtgtt tcaggctaac      1560
     caagaaaacc tgcctattct taagcgggca gtagcgggag atgcctctga gtcggcgctc      1620
     ttaaagtgca ttgaagtctg ctgcggctcc gtgatggaga tgagggagaa atacagcaag      1680
     atagtggaga ttcccttcaa ctccaccaac aagtaccagt tgtccattca caagaaccca      1740
     aatgcatctg agcccaaaca cctgctagtg atgaagggcg ccccagaaag gatcctggac      1800
     cgctgcagct ccatccttct ccacggcaag gagcagccac tggatgaaga gctgaaggac      1860
     gcttttcaga acgcctacct agagctgggg ggccttggag aacgtgtgct aggtttctgc      1920
     cacctcctcc tgcctgacga acagtttccc gaaggcttcc agtttgacac tgacgatgtc      1980
     aatttccccg tggataacct ctgcttcgtg ggtcttatct ccatgattga ccctccccga      2040
     gctgctgtcc ccgatgctgt gggcaaatgc cgcagcgctg ggattaaggt catcatggtt      2100
     acaggagacc atccaatcac agcgaaagcc attgccaagg gggtaggcat tatctcagaa      2160
     ggcaatgaga ctgtggaaga cattgctgcc cgcctcaaca ttccagtgaa ccaggtgaac      2220
     cccagagatg ccaaggcctg tgtggtccac ggcagtgacc tgaaggacat gacctccgag      2280
     gagctggatg acatcttgcg gtaccacaca gagatcgtct ttgccaggac ctctcctcag      2340
     cagaagctca tcattgtgga gggctgccag cggcagggcg ccatcgtggc cgtcacaggg      2400
     gatggtgtca atgactctcc agctttgaaa aaggcagata ttggggttgc catggggatt      2460
     gttggctctg atgtgtccaa gcaagctgct gacatgatcc ttctggatga caactttgcc      2520
     tccattgtga ctggagtaga ggaaggtcgt ctgatttttg ataacttgaa gaaatccatc      2580
     gcttacaccc taaccagtaa cattccggaa atcaccccct tcttgatatt tattattgca      2640
     aacattccac tgcccctggg gactgtgacc atcctctgca ttgacttggg cactgacatg      2700
     gttcctgcca tctccctggc ctacgagcaa gctgagagcg acatcatgaa gaggcagccc      2760
     agaaacccca aaacggacaa acttgtgaac gagcgtctga tcagcatggc ctatggacag      2820
     atcggtatga tccaggccct gggaggcttc ttcacttact ttgtgattct ggctgagaac      2880
     ggtttcctgc cctttcacct gttgggcatc cgagagacct gggatgaccg ctgggtcaac      2940
     gatgtggagg acagctacgg gcagcagtgg acctacgagc agaggaagat cgtggagttc      3000
     acctgccata cagcgttctt tgtcagtatt gtggtagtgc agtgggccga cttggtcatc      3060
     tgcaagacca gaaggaattc tgtcttccag cagggaatga agaacaagat cttgatattt      3120
     ggcctctttg aagagacagc ccttgctgct ttcttatcct actgccccgg gatgggggca      3180
     gcccttagga tgtatcccct caaacctaca tggtggttct gtgccttccc ctactccctt      3240
     ctcatctttg tgtatgacga ggtgcggaag ctcattatca ggcggcgccc tggcggctgg      3300
     gtggagaagg aaacctacta ctagcccact gccctgcacg ccgtggaaca ttgtgccaca      3360
     cactgcaccc acccctaccc cctctttgtg tacttcaagt cttggagctc ggaactctac      3420
     cctggtagga aagcaccaaa gcatgtgggg atgcagacgt cctggaatga agcatgtagc      3480
     tgtaacgggg ggcggggcgg gggggagggc tgcctgagaa acaccgtgta cggggacgac      3540
     agcgggcaag gtttatacgt gcctttttgt ttttgtaaaa aaggaaaacc tggaaagact      3600
     gaaagattac gttttatatc tggattttta caaataaaga tggctattat aacggaaaaa      3660
     aaaaaaaaaa aaaaaaaaaa aaaaaa                                           3686
//


spacer
spacer