Dbfetch

ID   BC025550; SV 1; linear; mRNA; STD; MUS; 2085 BP.
XX
AC   BC025550;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, pi, mRNA (cDNA
DE   clone MGC:38123 IMAGE:5320737), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2085
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2085
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (06-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3917639f82c767f5f506327a9d6f5282.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 56 Row: f Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981871.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2085
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38123 IMAGE:5320737"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2085
FT                   /gene="Gabrp"
FT                   /note="synonym: MGC38123"
FT   misc_difference 1..11
FT                   /gene="Gabrp"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             144..1466
FT                   /codon_start=1
FT                   /gene="Gabrp"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW7"
FT                   /protein_id="AAH25550.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   misc_difference 296
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2062..2085
FT                   /gene="Gabrp"
FT                   /note="polyA tail: 24 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2085 BP; 582 A; 499 C; 431 G; 573 T; 0 other;
     ccacgcgtcc ggaaaaggac cctggagacc caaaagagta tgctctgtgt gagagtcctg        60
     cctgagatct ggaaacacct gctgtaacag ctgcctggtg attcctcctt caaccttttt       120
     gtgtgtgaat cagctccttc aacatgagct acagcctcta tttggccttc ctgtgtctga       180
     gtctcctcac tcagaggacg tgcatccagg ggaaccaggt caatgtggag gtcagcagaa       240
     gtgacaagct ttccttacct ggctttgaga acctcactgc aggatataac aaatttctca       300
     ggcccaattt cggtggtgac ccagttcgga tagcactgac tctggacatc gccagcatct       360
     ctagcatctc agagagtaac atggactaca cagccactat atacctccgg cagcgttgga       420
     cagacccacg gctagtgttc gaaggcaaca agagctttac tctagatgcc cgccttgtgg       480
     agttcctctg ggtgccagac acttacattg tagagtccaa gaagtccttc ctccatgaag       540
     tcacagtggg aaacaggctc atccgcctct tctccaacgg cacagtcctg tacgcactta       600
     gaatcacaac aacagttaca tgtaacatgg atctgtctaa ataccccatg gacacacaga       660
     cctgcaagct gcagctagaa agttggggat acgatggcaa tgatgtggag ttctcctggc       720
     tgagagggaa tgactcggtg cgtggacttg aaaacctgcg ccttgctcag tacacaatcc       780
     aacagtattt caccctggtc accgtatccc agcaggagac aggaaactat acgagattgg       840
     ttttgcaatt tgagcttcgg aggaacgtcc tgtatttcat tctggaaacc tatgtccctt       900
     ccaccttcct ggtggtgtta tcctgggtct ccttttggat ctccctcgat tcagttcctg       960
     cgagaacctg cattggagtg acaacggtgt tatccatgac aacgctgatg atcggctccc      1020
     gcacatccct acccaacacc aactgcttca taaaggccat cgatgtgtac ctaggcatct      1080
     gcttcagctt cgtgtttggg gccttactgg agtatgcagt tgctcactac agctccttac      1140
     agcagatggc agtcaaagat agggggccag cgaaggactc ggaagaagtc aatatcacca      1200
     acatcatcaa cagctccatc tccagcttta aacggaagat tagctttgcc agcattgaaa      1260
     tctctggtga caatgtcaac tatagtgact tgacaatgaa agccagcgac aagtttaagt      1320
     ttgtcttccg agagaagatc agcagaatca ttgattattt cacaattcaa aaccccagca      1380
     atgtggatcg atactccaaa ctactatttc ctttgatttt tatgttggcc aatgtatttt      1440
     actgggcata ctacatgtat ttttgagacg ccattgaact cttgcatcac ataatgaggt      1500
     taagggtatt ctagaacatg tgtgtgcact tcagcttaga aagctacaaa tgggctaatg      1560
     taacaattat tctaagttgt gtagaagccc tagtgtgacc agattctata atagagtcat      1620
     tataaggcaa cccttttctt cttcaatttt ggacagaaca ccccctccac acacatacac      1680
     agaacccaag actgcgaacc tactcagggc tatttgctct ctggatccct ggtctgcatt      1740
     cactccataa aaatgtggga agatgattac atatattaag gggtttattt tctaaagaat      1800
     tcatagtgcc actgattaca tctctgtggc ccttataata tgctctcttg cctatttaaa      1860
     caccagtgtt ttctaatttt tgtttttcct tgaaatatga aatgtgggtt tgcgtcaatt      1920
     cattggtggt taccttgcct catcaaccta ataccagatg ggttcttagt gttatttaat      1980
     accacagaag aattgtcccc aaattctaat acatcctatt attcacaaat cagatgtaaa      2040
     tgaataaaat tagtggatca aaaaaaaaaa aaaaaaaaaa aaaaa                      2085
//