Dbfetch

ID   BC025040; SV 1; linear; mRNA; STD; MUS; 1978 BP.
XX
AC   BC025040;
XX
DT   12-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 9)
XX
DE   Mus musculus oxoglutarate dehydrogenase (lipoamide), mRNA (cDNA clone
DE   IMAGE:4949432), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1978
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1978
RA   Strausberg R.;
RT   ;
RL   Submitted (05-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 006da8bc8c60217d039d92dfbb2b8278.
DR   Ensembl-Gn; ENSMUSG00000020456; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018020; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017961; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018413; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017336; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017749; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017851; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017930; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017390; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000101554; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0027975; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0027945; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0027906; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0027924; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027722; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028424; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027327; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027651; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0027778; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0027765; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0027893; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028452; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027232; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 60 Row: g Column: 22
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1978
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="IMAGE:4949432"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..995
FT                   /codon_start=3
FT                   /gene="Ogdh"
FT                   /product="Ogdh protein"
FT                   /db_xref="GOA:Q60597"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="MGI:MGI:1098267"
FT                   /db_xref="PDB:3E2H"
FT                   /db_xref="PDB:3TF7"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60597"
FT                   /protein_id="AAH25040.1"
FT                   /translation="NVDKRTCIPMNHLWPNQAPYTVCNSSLSEYGVLGFELGFAMASPN
FT                   ALVLWEAQFGDFNNMAQCIIDQFICPGQAKWVRQNGIVLLLPHGMEGMGPEHSSARPER
FT                   FLQMCNDDPDVLPDLQEENFDINQLYDCNWIVVNCSTPGNFFHVLRRQILLPFRKPLIV
FT                   FTPKSLLRHPEARTSFDEMLPGTHFQRVIPENGPAAQDPHKVKRLLFCTGKVYYDLTRE
FT                   RKARNMEEEVAITRIEQLSPFPFDLLLKEAQKYPNAELAWCQEEHKNQGYYDYVKPRLR
FT                   TTIDRAKPVWYAGRDPAAAPATGNKKTHLTELQRFLDTAFDLDAFKKFS"
XX
SQ   Sequence 1978 BP; 485 A; 560 C; 473 G; 460 T; 0 other;
     agaatgttga caaaagaacc tgcatcccca tgaaccacct ttggccaaat caggcccctt        60
     acactgtatg caacagctcg ctgtctgagt acggtgtcct gggctttgag ctgggctttg       120
     ccatggctag ccctaatgct ctggttctct gggaggccca gtttggtgac ttcaacaaca       180
     tggcacagtg catcattgac cagttcatct gcccaggaca ggcaaagtgg gtgcggcaga       240
     atggcattgt gctcctgctg cctcatggca tggaaggcat gggtcccgag cattcctctg       300
     cccgcccaga gcggtttctg cagatgtgca atgatgaccc agatgtcctg cctgacctgc       360
     aggaagaaaa ctttgacatc aatcagctct atgactgcaa ctggattgtt gtcaactgtt       420
     ccacccctgg caacttcttc catgtgctgc gacgacagat cttgctgccc ttccggaagc       480
     cgttaatcgt cttcactccc aaatccctcc tgcgccaccc tgaggcaaga actagctttg       540
     acgagatgct gccaggaacg cacttccagc gtgtgatccc agaaaatgga cctgcagctc       600
     aggacccaca caaagtcaag agacttctct tctgcactgg gaaggtgtac tatgacctca       660
     cccgagagcg caaagccagg aacatggagg aggaggtggc tattacaagg attgagcagc       720
     tatcaccatt cccctttgac ctcctgctga aagaggcaca gaagtatccc aatgctgagc       780
     tggcctggtg ccaggaagag cacaagaacc aaggctacta tgactatgtc aagccaagac       840
     ttcgtaccac cattgaccgt gctaagcctg tctggtatgc tggccgagac ccggcagctg       900
     ctccagccac tggcaacaag aaaacacacc tgacagagct gcagcgcttt ctggacacag       960
     cctttgacct ggacgcattc aagaaattct cttagatgct cctggagttg atgaggccat      1020
     ggcccccatg tccatgacgc tctttgcttc tcaactaaag aatagtgcct cagcactgtc      1080
     cacacgtccc ttcgctgtgc cacaccaccc ctgttctcat aggaattaag ttgtccactg      1140
     cagtgctcag ctgctccccg gtcacatgct gcccagcctg tgccgacttc tctcaggctg      1200
     cacaccgttc atggagaccg gaaggagcag aataaggaaa gggcccctct caggacatcc      1260
     tagagaagga aggcagctct ggccccaccc atgcccccag tgcaatcctc cagggtagga      1320
     acagaaccct atgtggcttc ccagggtact agcactcagc cctcgtcacc catcaagtcg      1380
     cagattcaag gccaggagta gtttcatctt gctagggcca agctgagagc tcatggagga      1440
     actatagctg ccaggatttg ggagtcatca ggatgttgtg tgaatagaga ttgtcatggg      1500
     gtatttagag gactttagca gtgatgttag tctagccctg ctacccttct tgggtttggg      1560
     ctgtatgtgg gaaacttacc ccagctacca cgcctggaga gcttggctct gagtacggcc      1620
     cagaagctcc attggctccc aacgccaggc actgctgcct cttggtcctg ctgcctctgc      1680
     tctcctgacc cctccccagt cacttcattt tctctgttgt tcccttgaac acacagaagc      1740
     tgttgacgaa ttcttttttt tgctgtgcca aggcaggtca aaagcagatc agtggataag      1800
     agcaagttgt cccaaggagc cagctgtcct tcctccctct tttgacctcc actgggacac      1860
     acctgattta tttattttgg ttaaaaaaaa aaaaggaaat gaaaaaagaa caaccacctt      1920
     tgcattgcat cggcttgacc cataaactaa gttatcatgg ccaaaaaaaa aaaaaaaa        1978
//