Dbfetch

ID   BC024880; SV 1; linear; mRNA; STD; MUS; 1310 BP.
XX
AC   BC024880;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus small nuclear ribonucleoprotein N, mRNA (cDNA clone MGC:18604
DE   IMAGE:3987218), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1310
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1310
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 426769ee4e5b3e7753c1dc56975a44f9.
DR   Ensembl-Gn; ENSMUSG00000102252; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032303; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032239; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032315; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032028; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032808; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031357; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031993; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032104; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032231; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031475; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084268; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084217; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083814; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084737; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083754; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083796; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083958; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083841; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085013; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083743; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082868; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 23 Row: m Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328217.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1310
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:18604 IMAGE:3987218"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1310
FT                   /gene="Snrpn"
FT                   /note="synonyms: Peg4, SMN, HCERN3, MGC18604, MGC30325"
FT   CDS             449..1171
FT                   /codon_start=1
FT                   /gene="Snrpn"
FT                   /product="small nuclear ribonucleoprotein N"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="AAH24880.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
FT   misc_difference 1298..1310
FT                   /gene="Snrpn"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1310 BP; 348 A; 332 C; 329 G; 301 T; 0 other;
     gccggagatg ccagacgctt ggttctgagg agtgatttgc aacgcaatgg agcgaggaag        60
     ggatcgctta cacttgagaa gaactactga acagcacgtg cccgaggtcg aggtccaggt       120
     caaacgtcga aggacagcct cactgagcaa ccaagagtgt cacttgtacc cacgacgttc       180
     tcagcaacag caagttcctg tggtggattt ccaggcagaa ctaagacagg cattcttagc       240
     tgagacacca agaggtggtt aaagcagtat tgcaacttca aggtggtgga attcaaggaa       300
     aacaggaccc atcctctgtc tgtgaaactt tggtcaagct tacattgttt gttaatagcc       360
     tgcatcgaac ctttatttat atcccttccc cgagtattaa ggatcttgaa attttagtgt       420
     tgacaacggc tattgtggaa cagcaatcat gactgtgggt aagagtagca agatgctgca       480
     gcacattgac tataggatga gatgtatcct gcaagatggg agaatcttca ttggcacctt       540
     caaggctttt gacaagcata tgaatttgat cctctgtgat tgtgatgagt tcaggaagat       600
     caagccaaag aatgcaaaac agccagaacg tgaagaaaaa cgggttttgg gtctggtctt       660
     gctacgtggg gagaacttgg tttcaatgac tgtggagggc ccacctccta aagatactgg       720
     cattgctcgt gtgcctcttg ctggcgctgc aggtggccct ggggttggaa gagcagctgg       780
     cagaggagtg ccagcaggtg tacctattcc ccaggctcct gctggattag caggccctgt       840
     cagaggagtt ggaggcccat cccagcaggt catgacccca cagggaagag gcactgttgc       900
     agctgctgct gttgctgcta ctgctagcat tgcaggagcc ccaacccagt acccgccagg       960
     acggggaact ccacctccac ctgtaggcag agcaacccca cctccaggca ttatggctcc      1020
     tccacctggt atgagaccac ccatgggccc acccattggg cttccccctg ctcgtgggac      1080
     acctataggc atgcctcctc caggaatgag accccctcca ccaggaatta gaggcccacc      1140
     tcccccagga atgcgcccac caagacccta agatacagtt gataaatctc agcccttctc      1200
     ttcccctaca atgcttcttg tgaaattgtg tacctgcaag ctttttgacc cctcttactg      1260
     cattaactat agataataaa tacatagagc aattcaaaaa aaaaaaaaaa                 1310
//