spacer

EBI Dbfetch

ID   BC024643; SV 1; linear; mRNA; STD; MUS; 2030 BP.
XX
AC   BC024643;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus albumin, mRNA (cDNA clone MGC:27522 IMAGE:4242076), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2030
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2030
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 399b3f2080f8a9d60610b50310c31722.
DR   Ensembl-Gn; ENSMUSG00000029368; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000031314; mus_musculus.
DR   EuropePMC; PMC1513230; 16674826.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 37 Row: n Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33859505.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2030
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:27522 IMAGE:4242076"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2030
FT                   /gene="Alb"
FT   CDS             21..1847
FT                   /codon_start=1
FT                   /gene="Alb"
FT                   /product="albumin"
FT                   /db_xref="GOA:P07724"
FT                   /db_xref="InterPro:IPR000264"
FT                   /db_xref="InterPro:IPR014760"
FT                   /db_xref="InterPro:IPR020857"
FT                   /db_xref="InterPro:IPR020858"
FT                   /db_xref="InterPro:IPR021177"
FT                   /db_xref="MGI:MGI:87991"
FT                   /db_xref="UniProtKB/Swiss-Prot:P07724"
FT                   /protein_id="AAH24643.1"
FT                   /translation="MKWVTFLLLLFVSGSAFSRGVFRREAHKSEIAHRYNDLGEQHFKG
FT                   LVLIAFSQYLQKCSYDEHAKLVQEVTDFAKTCVADESAANCDKSLHTLFGDKLCAIPNL
FT                   RENYGELADCCTKQEPERNECFLQHKDDNPSLPPFERPEAEAMCTSFKENPTTFMGHYL
FT                   HEVARRHPYFYAPELLYYAEQYNEILTQCCAEADKESCLTPKLDGVKEKALVSSVRQRM
FT                   KCSSMQKFGERAFKAWAVARLSQTFPNADFAEITKLATDLTKVNKECCHGDLLECADDR
FT                   AELAKYMCENQATISSKLQTCCDKPLLKKAHCLSEVEHDTMPADLPAIAADFVEDQEVC
FT                   KNYAEAKDVFLGTFLYEYSRRHPDYSVSLLLRLAKKYEATLEKCCAEANPPACYGTVLA
FT                   EFQPLVEEPKNLVKTNCDLYEKLGEYGFQNAILVRYTQKAPQVSTPTLVEAARNLGRVG
FT                   TKCCTLPEDQRLPCVEDYLSAILNRVCLLHEKTPVSEHVTKCCSGSLVERRPCFSALTV
FT                   DETYVPKEFKAETFTFHSDICTLPEKEKQIKKQTALAELVKHKPKATAEQLKTVMDDFA
FT                   QFLDTCCKAADKDTCFSTEGPNLVTRCKDALA"
FT   misc_difference 2017..2030
FT                   /gene="Alb"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2030 BP; 586 A; 491 C; 468 G; 485 T; 0 other;
     ccccactagc ctctggcaaa atgaagtggg taacctttct cctcctcctc ttcgtctccg        60
     gctctgcttt ttccaggggt gtgtttcgcc gagaagcaca caagagtgag atcgcccatc       120
     ggtataatga tttgggagaa caacatttca aaggcctagt cctgattgcc ttttcccagt       180
     atctccagaa atgctcatac gatgagcatg ccaaattagt gcaggaagta acagactttg       240
     caaagacgtg tgttgccgat gagtctgccg ccaactgtga caaatccctt cacactcttt       300
     ttggagataa gttgtgtgcc attccaaacc tccgtgaaaa ctatggtgaa ctggctgact       360
     gctgtacaaa acaagagccc gaaagaaacg aatgtttcct gcaacacaaa gatgacaacc       420
     ccagcctgcc accatttgaa aggccagagg ctgaggccat gtgcacctcc tttaaggaaa       480
     acccaaccac ctttatggga cactatttgc atgaagttgc cagaagacat ccttatttct       540
     atgccccaga acttctttac tatgctgagc agtacaatga gattctgacc cagtgttgtg       600
     cagaggctga caaggaaagc tgcctgaccc cgaagcttga tggtgtgaag gagaaagcat       660
     tggtctcatc tgtccgtcag agaatgaagt gctccagtat gcagaagttt ggagagagag       720
     cttttaaagc atgggcagta gctcgtctga gccagacatt ccccaatgct gactttgcag       780
     aaatcaccaa attggcaaca gacctgacca aagtcaacaa ggagtgctgc catggtgacc       840
     tgctggaatg cgcagatgac agggcggaac ttgccaagta catgtgtgaa aaccaggcga       900
     ctatctccag caaactgcag acttgctgcg ataaaccact gttgaagaaa gcccactgtc       960
     ttagtgaggt ggagcatgac accatgcctg ctgatctgcc tgccattgct gctgattttg      1020
     ttgaggacca ggaagtgtgc aagaactatg ctgaggccaa ggatgtcttc ctgggcacgt      1080
     tcttgtatga atattcaaga agacaccctg attactctgt atccctgttg ctgagacttg      1140
     ctaagaaata tgaagccact ctggaaaagt gctgcgctga agccaatcct cccgcatgct      1200
     acggcacagt gcttgctgaa tttcagcctc ttgtagaaga gcctaagaac ttggtcaaaa      1260
     ccaactgtga tctttacgag aagcttggag aatatggatt ccaaaatgcc attctagttc      1320
     gctacaccca gaaagcacct caggtgtcaa ccccaactct cgtggaggct gcaagaaacc      1380
     taggaagagt gggcaccaag tgttgtacac ttcctgaaga tcagagactg ccttgtgtgg      1440
     aagactatct gtctgcaatc ctgaaccgtg tgtgtctgct gcatgagaag accccagtga      1500
     gtgagcatgt taccaagtgc tgtagtggat ccctggtgga aaggcggcca tgcttctctg      1560
     ctctgacagt tgatgaaaca tatgtcccca aagagtttaa agctgagacc ttcaccttcc      1620
     actctgatat ctgcacactt ccagagaagg agaagcagat taagaaacaa acggctcttg      1680
     ctgagctggt gaagcacaag cccaaggcta cagcggagca actgaagact gtcatggatg      1740
     actttgcaca gttcctggat acatgttgca aggctgctga caaggacacc tgcttctcga      1800
     ctgagggtcc aaaccttgtc actagatgca aagacgcctt agcctaaaca catcacaacc      1860
     acaaccttct caggctaccc tgagaaaaaa agacatgaag actcaggact catcttttct      1920
     gttggtgtaa aatcaacacc ctaaggaaca caaatttctt taaacatttg acttcttgtc      1980
     tctgtgctgc aattaataaa aaatggaaag aatctaaaaa aaaaaaaaaa                 2030
//


spacer
spacer