Dbfetch

ID   BC024621; SV 2; linear; mRNA; STD; MUS; 899 BP.
XX
AC   BC024621;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   14-JUL-2017 (Rel. 133, Last updated, Version 16)
XX
DE   Mus musculus gamma-aminobutyric acid receptor associated protein, mRNA
DE   (cDNA clone MGC:25654 IMAGE:4459651), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-899
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-899
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
RN   [3]
RC   Sequence update by database staff to remove vector contamination
RP   1-899
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (10-JUL-2017) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 03d0873c4055b707d0e8d1573eb2f6d3.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018512; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018515; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018328; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018966; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017883; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018410; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018480; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018423; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019008; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017657; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017937; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030169; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030108; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030082; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0029897; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0030603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0029597; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0029814; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0029952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0029943; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030067; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0029927; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0030631; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029314; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029389; mus_musculus_wsbeij.
XX
CC   On Jul 10, 2017 this sequence version replaced BC024621.1.
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: h Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254379.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..899
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:25654 IMAGE:4459651"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..899
FT                   /gene="Gabarap"
FT   CDS             102..455
FT                   /codon_start=1
FT                   /gene="Gabarap"
FT                   /product="gamma-aminobutyric acid receptor associated
FT                   protein"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="AAH24621.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
XX
SQ   Sequence 899 BP; 217 A; 246 C; 205 G; 231 T; 0 other;
     gccaagtctg ttcgtcgaag ccgcctccgc cgccgccccc tgtcccggcc ccccccctgg        60
     gttccctcag cccagctcgg tccagcccgg ttctcgggag aatgaagttc gtgtacaaag       120
     aggagcatcc gttcgagaaa cgccgctctg agggcgagaa aatccgaaag aaatacccag       180
     accgggtccc ggtgatagtg gaaaaagccc ccaaagctcg gataggagac ctggacaaaa       240
     agaaatacct ggtgccttct gatcttacag ttggtcaatt ctacttcttg atccggaagc       300
     gaattcatct ccgtgctgaa gatgccttgt ttttctttgt caacaatgtc attccaccca       360
     ccagtgccac gatgggtcag ctgtaccagg aacaccatga agaagacttc tttctataca       420
     ttgcctacag tgatgaaagc gtctatggtc tgtgaagctg ctgtacctga ggtggggggt       480
     tccattctac gaagagaggt ggcgctcctt ccttgacatc cagttcctcc ttcaggctca       540
     aacaccacct cctttcttca ggacctgcac ttaatgtttg aggctgtctc tccagtccct       600
     ctcagcagga ggggtaatgg tagatacagc ctccatacat ctctttctcc ccttgtttac       660
     cctccattcc cactctgatt tagacttctt gattgtcgat ctctgtcaca tccgatgatt       720
     gttttggttt ctattccctt tctaactgcc catcgggctc agaaccccaa taatcccttc       780
     ctttcactat cttctttttg gggggtaggt ggaagggatt gacattggat gggggaggta       840
     ggaggcacat caataaaaag gaaaccaccg agctgaattg aaaaaaaaaa aaaaaaaaa        899
//