spacer

EBI Dbfetch

ID   BC024621; SV 1; linear; mRNA; STD; MUS; 924 BP.
XX
AC   BC024621;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus gamma-aminobutyric acid receptor associated protein, mRNA
DE   (cDNA clone MGC:25654 IMAGE:4459651), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-924
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-924
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3387e6ff20a79f476582d336a40d6b86.
DR   Ensembl-Gn; ENSMUSG00000018567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018711; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 31 Row: h Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 40254379.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..924
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:25654 IMAGE:4459651"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..924
FT                   /gene="Gabarap"
FT   misc_difference 1..24
FT                   /gene="Gabarap"
FT                   /note="24 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             127..480
FT                   /codon_start=1
FT                   /gene="Gabarap"
FT                   /product="gamma-aminobutyric acid receptor associated
FT                   protein"
FT                   /db_xref="GOA:Q9DCD6"
FT                   /db_xref="InterPro:IPR004241"
FT                   /db_xref="MGI:MGI:1861742"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DCD6"
FT                   /protein_id="AAH24621.1"
FT                   /translation="MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
FT                   KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFF
FT                   LYIAYSDESVYGL"
FT   misc_difference 165
FT                   /gene="Gabarap"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 908..924
FT                   /gene="Gabarap"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 924 BP; 219 A; 253 C; 219 G; 233 T; 0 other;
     cggacgcgtg ggcggacgcg tgggcgccaa gtctgttcgt cgaagccgcc tccgccgccg        60
     ccccctgtcc cggccccccc cctgggttcc ctcagcccag ctcggtccag cccggttctc       120
     gggagaatga agttcgtgta caaagaggag catccgttcg agaaacgccg ctctgagggc       180
     gagaaaatcc gaaagaaata cccagaccgg gtcccggtga tagtggaaaa agcccccaaa       240
     gctcggatag gagacctgga caaaaagaaa tacctggtgc cttctgatct tacagttggt       300
     caattctact tcttgatccg gaagcgaatt catctccgtg ctgaagatgc cttgtttttc       360
     tttgtcaaca atgtcattcc acccaccagt gccacgatgg gtcagctgta ccaggaacac       420
     catgaagaag acttctttct atacattgcc tacagtgatg aaagcgtcta tggtctgtga       480
     agctgctgta cctgaggtgg ggggttccat tctacgaaga gaggtggcgc tccttccttg       540
     acatccagtt cctccttcag gctcaaacac cacctccttt cttcaggacc tgcacttaat       600
     gtttgaggct gtctctccag tccctctcag caggaggggt aatggtagat acagcctcca       660
     tacatctctt tctccccttg tttaccctcc attcccactc tgatttagac ttcttgattg       720
     tcgatctctg tcacatccga tgattgtttt ggtttctatt ccctttctaa ctgcccatcg       780
     ggctcagaac cccaataatc ccttcctttc actatcttct ttttgggggg taggtggaag       840
     ggattgacat tggatggggg aggtaggagg cacatcaata aaaaggaaac caccgagctg       900
     aattgaaaaa aaaaaaaaaa aaaa                                              924
//


spacer
spacer