Dbfetch

ID   BC024575; SV 1; linear; mRNA; STD; MUS; 1359 BP.
XX
AC   BC024575;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus aminolevulinic acid synthase 2, erythroid, mRNA (cDNA clone
DE   IMAGE:5054102), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1359
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1359
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e50bbed977e4bcae4d09683fa9adda3a.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 58 Row: m Column: 22
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1359
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="IMAGE:5054102"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1359
FT                   /gene="Alas2"
FT                   /note="synonyms: ALAS, ALAS-E"
FT   CDS             8..1216
FT                   /codon_start=1
FT                   /gene="Alas2"
FT                   /product="Alas2 protein"
FT                   /db_xref="GOA:Q8R1G3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR010961"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="MGI:MGI:87990"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R1G3"
FT                   /protein_id="AAH24575.1"
FT                   /translation="MASKDVSVWCSNDYLGISRHPRVLQAIEETLKNHGAGAGGTRNIS
FT                   GTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKLLPGCEIYSDAGNHASMI
FT                   QGIRNSGAAKFVFRHNDPGHLKKLLEKSDPKTPKIVAFETVHSMDGAICPLEELCDVAH
FT                   QYGALTFVDEVHAVGLYGARGAGIGERDGIMHKLDIISGTLGKAFGCVGGYIASTRDLV
FT                   DMVRSYAAGFIFTTSLPPMVLSGALESVRLLKGEEGQALRRAHQRNVKHMRQLLMDRGF
FT                   PVIPCPSHIIPIRVGNAALNSKICDLLLSKHSIYVQAINYPTVPRGEELLRLAPSPHHS
FT                   PQMMENFVEKLLLAWTEVGLPLQDVSVAACNFCHRPVHFELMSEWERSYFGNMGPQYVT
FT                   TYA"
FT   misc_difference 1344..1359
FT                   /gene="Alas2"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1359 BP; 309 A; 362 C; 351 G; 337 T; 0 other;
     ggcatctatg gcatcaaagg atgtttctgt ttggtgtagt aatgactatt tgggcataag        60
     cagacaccct cgtgtcttgc aggccataga ggagaccctg aagaatcatg gagctggagc       120
     tgggggcact cgcaatatct caggtaccag caagtttcat gtggagcttg aacaggagct       180
     ggctgaacta caccagaaag actcagctct gctcttctcc tcctgttttg tggccaatga       240
     ttctactctc tttacactgg ccaagcttct gccagggtgt gagatctact cagatgcagg       300
     caatcatgcc tccatgatcc aaggcattcg caacagtggt gcagccaagt ttgtcttcag       360
     acacaatgac ccaggccacc tgaagaaact tctcgagaag tctgatccca agacaccaaa       420
     aattgtggct tttgagactg ttcattccat ggatggtgcc atctgtcctc tggaggaatt       480
     gtgtgatgtg gcccaccagt atggagccct gaccttcgta gatgaagtcc atgctgtagg       540
     actgtatgga gcccggggtg caggtatcgg ggagcgtgat ggaattatgc acaagcttga       600
     catcatctct ggaactcttg gcaaggcctt tggttgcgtc ggtggctata tagccagcac       660
     tcgggacttg gtggacatgg tgcgctccta cgctgcaggc ttcatcttta ccacttcact       720
     gcctcccatg gtgctctctg gggctctaga atctgtgcgc ctactcaagg gagaggaggg       780
     tcaagccctg aggcgggcac accagcgcaa tgtcaaacac atgcgccagc tgctaatgga       840
     caggggcttt cctgttatcc cctgtcccag ccacatcatc cccatcaggg tgggtaatgc       900
     agcactcaac agcaagatct gtgatcttct gctctccaag cacagcatct atgtgcaggc       960
     catcaactac ccaactgtgc ctcgtggtga ggagctactg cgcttggccc cctcccccca      1020
     ccacagccct cagatgatgg aaaactttgt ggagaagctg ctgctggcct ggactgaggt      1080
     ggggctgccc ctccaagatg tgtctgtggc tgcatgcaac ttctgtcatc gtcctgtgca      1140
     ctttgaactt atgagcgagt gggagcgatc ctactttggg aacatgggac cccaatatgt      1200
     taccacctat gcttaaggag ccagctgcct tggatgccag ctccacctgc actccccctg      1260
     gggctgggct tcctcctgct ctctgctttc ctgtgtgctt ctggctgact tgattctgaa      1320
     aataaagagc aacttgaaac attaaaaaaa aaaaaaaaa                             1359
//