spacer

EBI Dbfetch

ID   BC024559; SV 1; linear; mRNA; STD; MUS; 1952 BP.
XX
AC   BC024559;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus MAP kinase-activated protein kinase 2, mRNA (cDNA clone
DE   IMAGE:5003277), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1952
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1952
RA   Strausberg R.;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; c9b5649bbc07fdff65619aebdf15b149.
DR   Ensembl-Gn; ENSMUSG00000016528; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016672; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 58 Row: h Column: 1
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1952
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="IMAGE:5003277"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..548
FT                   /codon_start=3
FT                   /gene="Mapkapk2"
FT                   /product="Mapkapk2 protein"
FT                   /db_xref="GOA:Q8R3U8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027442"
FT                   /db_xref="MGI:MGI:109298"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R3U8"
FT                   /protein_id="AAH24559.1"
FT                   /translation="LTTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFY
FT                   SNHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHP
FT                   WIMQSTKVPQTPLHTSRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDASNPL
FT                   LLKRRKKARAVEDAALAH"
XX
SQ   Sequence 1952 BP; 419 A; 516 C; 526 G; 491 T; 0 other;
     ctttgaccac tccgtgttat acaccatact atgtggctcc ggaagtcctg ggcccggaga        60
     agtatgacaa gtcctgtgac atgtggtcct tgggtgtcat catgtatatt ttgctgtgtg       120
     ggtatccccc cttctattcc aatcacggcc ttgccatctc tccgggcatg aagactcgta       180
     ttcgaatggg ccagtatgaa tttcctaacc cggagtggtc agaagtatca gaagaagtga       240
     agatgcttat ccggaatctg ctaaaaacag agcccaccca gagaatgacc atcacagaat       300
     tcatgaacca cccctggatc atgcaatcta cgaaggtccc tcagactcca ctgcacacca       360
     gccgtgtcct gaaggaggac aaggaacgat gggaggatgt caaggaggag atgaccagtg       420
     ccttggccac gatgcgtgtt gactatgagc agatcaagat aaagaagata gaagacgcat       480
     ccaaccctct gcttctcaag aggcggaaga aagctcgtgc tgtggaggat gcggctctcg       540
     cccactgagc cgctctgtct cccacccact ggaggacaag caataactct acatgaatat       600
     attttttaga caaagagaca caagttgccc aatgctgcct cctgttctct tgggctgcgt       660
     ggcgcccaga aatgcctccg gctttattct gcccttggct ctggctcccc cgaggtgggg       720
     gctggaggat gtgtgagggg caaggtgctc ctgagcccgt tgctcctttg cattttatct       780
     gtaatttggc gtagagtttt tatggaacct gtcttcttgt ccttttcccc actcctcact       840
     ccttccccag gtcctttccc atctacaaag gctgaggctt atccacaggt gttgtggaag       900
     ttgttatagg gaaagtccct aggttgccct atctgtctcc tctggcctcc cactgtaacg       960
     tggggtcctc actggctcta gaatctggga gttccaggga gaaggcagca gagtggcagt      1020
     aggtggctct tgcctcccgc tgaagccctt agacatcacc agtgtgcaca acagagcagc      1080
     acatgtgtgt gcatgtgtgt gtatgcctgg atccatgcca gcgactgggc attggagggt      1140
     ctagggaagg cggggctaca gggactcctg cttgaactga gcctgcctaa atgcctaggt      1200
     agcttgtcta gatccagagc caggtaattg tggcctctgt gttagctggg caggggaggc      1260
     agtgaggggt tggggggcac tgacagccat caggaggact gggtcccctc aggacccctt      1320
     tccctgctgg tcccagatcc ctgaggcact gatctactga gtagcctctg cttgcccttc      1380
     ttgccacgat taacccactc ttgtcgagtt ctctgaaatt tttagccatt tctcaatggg      1440
     ctgtccactc ccacggtgag cctgggaagg ttctatgcct ggaaaggcag ttgcatttca      1500
     tgcatctccc ctgatctctg gggtacctgc caacctccct tcgacaaggg caggaccacg      1560
     tgtggtcttc ctggatttcc accatgtggt ctggtggatg ggacagtctt cgcaccaaag      1620
     atgtcttgac tctgtccctg cccactagcc accttaccct ctaactactc aacctgggtg      1680
     ggggctcccc aggattgagg aggagcaggc ggggaagagt ctttgtgcca tggtccccca      1740
     tgcccctcct gctggaggag gggtgtctcc ctcaggggtt ggtggaggag gggctcttgg      1800
     gcatccctgg gcctggggca gggcccagat gtctgcagct cctcccatgt ctttgatggt      1860
     gtgttcaaca ctcagactgt tgtaaactct cgttttgtat gagcaaaatt gtctttacta      1920
     aacaaattta atagttaaaa aaaaaaaaaa aa                                    1952
//


spacer
spacer