spacer

EBI Dbfetch

ID   BC024347; SV 1; linear; mRNA; STD; MUS; 670 BP.
XX
AC   BC024347;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus presenilin enhancer 2 homolog (C. elegans), mRNA (cDNA clone
DE   MGC:35751 IMAGE:4984284), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-670
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-670
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-MAR-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; a856aedf97ff98be85206256f6b6e9f7.
DR   Ensembl-Gn; ENSMUSG00000036835; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043898; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 59 Row: p Column: 9
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981294.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..670
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:35751 IMAGE:4984284"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..670
FT                   /gene="Psenen"
FT   CDS             216..521
FT                   /codon_start=1
FT                   /gene="Psenen"
FT                   /product="presenilin enhancer 2 homolog (C. elegans)"
FT                   /db_xref="GOA:Q9CQR7"
FT                   /db_xref="InterPro:IPR019379"
FT                   /db_xref="MGI:MGI:1913590"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CQR7"
FT                   /protein_id="AAH24347.1"
FT                   /translation="MNLERVSNEEKLNLCRKYYLGGFAFLPFLWLVNIFWFFREAFLAP
FT                   AYTEQSQIKGYVWRSAVGFLFWVIILATWITIFQIYRPRWGALGDYLSFTIPLGTP"
FT   misc_difference 652..670
FT                   /gene="Psenen"
FT                   /note="polyA tail: 19 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 670 BP; 160 A; 184 C; 163 G; 163 T; 0 other;
     cggagggggt ggggtgcgag gggggctggg caggagaaga aaaaaaaaag cgacaacaaa        60
     ctccactgaa aactgcggca tctcccgcaa atctcccgca aaggaatcca ggcagaaggg       120
     ataaaccgca ctggggcgtg gttgctcgtg atcttgcgtc tgtcatttgg gtcttgctct       180
     gcagaccctt aggaccaccg ggctccagcg caactatgaa cttggagcgg gtatccaatg       240
     aggagaagtt gaacctgtgc cggaagtact atcttggtgg atttgcgttc ctgccttttc       300
     tttggttagt caacattttc tggttcttca gagaggcgtt cctcgcccca gcctacacag       360
     agcagagcca aatcaaaggc tatgtttggc gctcagctgt gggcttcctc ttctgggtga       420
     tcattctcgc cacctggatc accatcttcc agatctaccg gccccgctgg ggcgctcttg       480
     gggactacct ctccttcacc attcccctgg gcactcccta acaacttcat aagctgctga       540
     tctgttcttt ctcccaggat gaaggcttct ctgctctagg ctttccctca gaccctgaag       600
     acatctgttt ctcatttccc atctgcccca ataaaggacc ctaactttaa aaaaaaaaaa       660
     aaaaaaaaaa                                                              670
//


spacer
spacer