spacer

EBI Dbfetch

ID   BC024149; SV 1; linear; mRNA; STD; MUS; 2686 BP.
XX
AC   BC024149;
XX
DT   26-FEB-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus arginine vasopressin receptor 1A, mRNA (cDNA clone MGC:13944
DE   IMAGE:4220075), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2686
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2686
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 9d656ca57d54148482f3e3ed92b0abb8.
DR   Ensembl-Gn; ENSMUSG00000020123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020323; mus_musculus.
DR   EuropePMC; PMC2121647; 17900345.
DR   EuropePMC; PMC2665843; 19052319.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: p Column: 11
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 33149328.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2686
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Co24"
FT                   /clone="MGC:13944 IMAGE:4220075"
FT                   /tissue_type="Colon, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2686
FT                   /gene="Avpr1a"
FT                   /note="synonyms: AVPR, V1a, V1aR, Avpr1"
FT   misc_difference 1..8
FT                   /gene="Avpr1a"
FT                   /note="8 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             305..1576
FT                   /codon_start=1
FT                   /gene="Avpr1a"
FT                   /product="arginine vasopressin receptor 1A"
FT                   /db_xref="GOA:Q62463"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001224"
FT                   /db_xref="InterPro:IPR001817"
FT                   /db_xref="InterPro:IPR015076"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1859216"
FT                   /protein_id="AAH24149.1"
FT                   /translation="MSFPRGSHDLPAGNSSPWWPLTTEGANSSREAAGLGEGGSPPGDV
FT                   RNEELAKLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQ
FT                   VLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQP
FT                   ARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDCWATFIPPWGTRAYVTWM
FT                   TSGVFVVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEAAGPFHKGLLVTPCV
FT                   SSVKSISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITAL
FT                   LASLNSCCNPWIYMFFSGHLLQDCVQSFPCCQSIAQKFAKDDSDSMSRRQTSYSNNRSP
FT                   TNSTGTWKDSPKSSKSIRFIPVST"
FT   misc_difference 2659..2686
FT                   /gene="Avpr1a"
FT                   /note="polyA tail: 28 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2686 BP; 673 A; 643 C; 704 G; 666 T; 0 other;
     cacgcgtcgg ttgggtgtag gggacagtct ccagccacta agatgagaag gagcgcatcc        60
     tgaggcagcc taagactgct ttgggagcag ggagagtccg ctcccttgcc tcggacaagc       120
     cggagcaggg acacgcaaga acatcccatc caaaaccact ctgagcgcgc gtgggattgc       180
     gcagcgaaga gagcgaggta aggaaggacg gtgcgcagaa cttaggacgc gggtcttcgg       240
     gtcctccgtg gagaagagga agcagcccac gaggaacagg gttccccggc tctgtgccga       300
     cagcatgagt ttcccgcgag gctcccacga tctgcccgcg ggcaactcca gcccgtggtg       360
     gcctctgacc accgagggcg ccaacagcag ccgggaagca gctgggctcg gggaaggcgg       420
     cagcccgccg ggggacgtac gcaacgagga gctggcgaag ctggaggtta ccgtgctggc       480
     ggtgattttc gtggtggccg tgctgggtaa tagcagtgtg ctgctggcgc tgcatcgcac       540
     gccacgcaag acatcccgca tgcatctctt catccgacac ctcagcctgg cagacctggc       600
     ggtcgccttc ttccaagtgt taccacagct gtgctgggac atcacctacc gcttccgcgg       660
     gccggactgg ctgtgccggg tggtgaagca cttgcaggtg tttgccatgt tcgcatcttc       720
     ctacatgctg gtggtgatga cggctgaccg ctacatcgcc gtgtgccacc cgctcaagac       780
     cctgcagcag cccgcgcgcc gctcgcgcct catgatcgcc gcctcttggg ggctgagttt       840
     cgttctgagc ataccacagt actttatctt ctctgtgatc gaatttgagg tgaacaatgg       900
     caccaaagcc caagattgct gggctacctt catcccgccc tggggtaccc gtgcctacgt       960
     gacctggatg accagcgggg tcttcgtggt acccgtgatc atcttgggta cctgctatgg      1020
     cttcatctgt taccacatct ggcgcaatgt ccgagggaag acagcatcgc gacagagcaa      1080
     aggcggcaag ggctctgggg aagccgcggg tcccttccac aaggggcttc tggtcacgcc      1140
     ttgtgtcagc agcgtgaaga gcatttcccg tgccaagatc cgcacagtga agatgacctt      1200
     tgtgattgta agcgcctaca tcctctgctg gacacctttc ttcatcgtcc agatgtggtc      1260
     agtctgggat accaatttcg tttggaccga ttccgaaaac ccttccacca cgatcacggc      1320
     gttactggct tccttgaaca gctgctgcaa cccgtggatc tacatgtttt ttagtggtca      1380
     tctcctacaa gattgtgtcc agagcttccc atgctgccaa agcatagcgc agaaattcgc      1440
     caaggatgac tcggatagca tgagccggag acagacatct tattctaaca accgaagccc      1500
     aacaaacagc actgggacgt ggaaggattc acctaaatct tcaaagtcca tcagatttat      1560
     ccctgtctcc acttgagccg catatccacg cagccagact cttggacggg gcttgtgtgt      1620
     ccagctagag agcttaagag taaatatgtt tatgtgacat agacataaat caactcagtg      1680
     tatacattgt ttctacaact tggtgtatac attgtttcta caattcagtg tatacattgt      1740
     ttctagctgt gtttttccca ttgctgtgac caaaacctga attcttttgc atagcatatt      1800
     aatgaaaatg taccacatgg gaaatgtata ggcctggttc gtaagcatac tgactttata      1860
     ttttgtggtt gatttttttt tattgtattt ttatgtctaa tgtgaggctt ggattggttt      1920
     aagtcatgtg ataagcactg ttgtttctac acaaagtgaa ctggtccgtg attgaaaacc      1980
     cagtgttgct gtcaatctgt gtgtcataaa atgtcagcaa gaggtagaga ggagttgggt      2040
     tgagggtggg aaggaggtag cttggtacct ggctgccctt ccttcagagt cctgacactc      2100
     tattagcact gaaaatcatg ctcaccaaca gacagaaggt ttgagaatgt tttaggacaa      2160
     taatttgtat gggggggggg tgccacactt tatagaggca taagagaaaa gatttctaca      2220
     gacattcttt gggatatttt aaacatccat ggaccagcac cataaggtag tctgtgctac      2280
     accagatgtt aacacttagt acctagtcgg tgaatccaga ttcagagatt ctaagtctcc      2340
     tagataactc cagacataag atactcaaaa catgttgatt taaatcagtt tatttatttc      2400
     ttcacatttc ccatccacac agcagggcca gaacacagag ggtgaagaca tgtggagaaa      2460
     cgggagacag acagaaagag aggggggtct gagccttgtg tctgttcctt catgaatgta      2520
     tgattttcag aaagatactt aaaaatattt aaagccttgg tttcttggct gtacaatggg      2580
     cttggtaaca ctcacctcac agggttgttg tgaagattaa ataatgttaa atgtgtgaag      2640
     agttattttt aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaa                     2686
//


spacer
spacer