Dbfetch

ID   BC023794; SV 1; linear; mRNA; STD; MUS; 3612 BP.
XX
AC   BC023794;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Mus musculus ATPase, Na+/K+ transporting, alpha 1 polypeptide, mRNA (cDNA
DE   clone MGC:38476 IMAGE:5351943), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3612
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3612
RA   Strausberg R.;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; dd6e85562f526710a550d0ed9aecba0b.
DR   Ensembl-Gn; ENSMUSG00000033161; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027676; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027635; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027601; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027648; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027377; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028091; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026833; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027352; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027495; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027463; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027602; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027493; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028146; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026913; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000036493; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062775; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0062803; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0062734; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062726; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0062410; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0063220; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062718; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0062375; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0062489; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0062457; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0062624; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0062456; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0063420; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0062255; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061682; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: j Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21450276.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3612
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38476 IMAGE:5351943"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3612
FT                   /gene="Atp1a1"
FT                   /note="synonym: MGC38419"
FT   CDS             189..3260
FT                   /codon_start=1
FT                   /product="Atp1a1 protein"
FT                   /db_xref="GOA:Q8VDN2"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR005775"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="MGI:MGI:88105"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VDN2"
FT                   /protein_id="AAH23794.1"
FT                   /translation="MGKGVGRDKYEPAAVSEHGDKKGKKAKKERDMDELKKEVSMDDHK
FT                   LSLDELHRKYGTDLSRGLTPARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLL
FT                   WIGAILCFLAYGIRSATEEEPPNDDLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKN
FT                   MVPQQALVIRNGEKMSINAEDVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGES
FT                   EPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQ
FT                   TPIAEEIEHFIHLITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATV
FT                   TVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHE
FT                   ADTTENQSGVSFDKTSATWFALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLK
FT                   CIEVCCGSVMEMREKYSKIVEIPFNSTNKYQLSIHKNPNASEPKHLLVMKGAPERILDR
FT                   CSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDV
FT                   NFPVDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIIS
FT                   EGNETVEDIAARLNIPVNQVNPRDAKACVVHGSDLKDMTSEELDDILRYHTEIVFARTS
FT                   PQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIVGSDVSKQAADMILLDD
FT                   NFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDL
FT                   GTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFV
FT                   ILAENGFLPFHLLGIRETWDDRWVNDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQ
FT                   WADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGAALRMYPLKPTWWF
FT                   CAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY"
FT   misc_feature    294..3224
FT                   /note="MgtA; Region: Cation transport ATPase [Inorganic ion
FT                   transport and metabolism]"
XX
SQ   Sequence 3612 BP; 860 A; 951 C; 991 G; 810 T; 0 other;
     ccacgcgtcc gggctcgagc tgcggctggg tctggggcgc ggagcctcgg cgggaggagg        60
     cggacacgtg gcagccctag ttcccgcctc tcggctcccc cggctccgct ctcccggccg       120
     ggagctgctc tcttctcttt ctagtctcca gcaacaggac ccggcgcggg gcccgcagcg       180
     ccgccaccat ggggaagggg gttggacgag acaagtatga gcctgccgct gtatcggagc       240
     atggtgacaa aaagggcaaa aaggccaaga aggaaaggga tatggatgag ctcaagaagg       300
     aagtgtctat ggacgaccat aaactcagcc tggatgaact ccatcgtaaa tacggaacag       360
     atttgagccg aggattaaca cctgcaaggg ccgctgagat cctggcccgg gatggcccca       420
     acgccctcac accccctccc actactcccg aatgggtgaa attctgccgg cagctctttg       480
     gaggcttttc catgttactg tggatcgggg ccattctttg tttcctggct tatggcatcc       540
     gaagtgctac agaagaggaa ccgccaaacg atgatctgta cctcggggtg gtgctctctg       600
     ctgtagtcat cataactggc tgtttctcct attatcaaga agcaaaaagc tccaagatca       660
     tggaatcctt caagaacatg gtccctcagc aagcccttgt gattcgaaat ggagagaaaa       720
     tgagcatcaa tgcggaggat gtcgtcgtcg gggatctggt ggaggtgaaa gggggagacc       780
     ggatccctgc tgatcttaga atcatatctg caaacggctg caaggtggat aactcctcac       840
     tcactggtga atcagaaccc cagactcggt ccccggattt cacaaacgag aaccccttgg       900
     agacaaggaa cattgccttc ttctcaacca actgtgtgga aggaaccgca cgtggcatcg       960
     tcgtgtacac tggggaccgc accgtgatgg gcaggattgc cacgcttgcc tctgggctag      1020
     aaggtggcca gacccccatt gctgaagaga ttgagcattt catccacctc atcaccgggg      1080
     tggccgtgtt cctgggggtg tctttcttca tcctttctct gatccttgag tacacctggc      1140
     tcgaggctgt catcttcctc attggtatca tcgtagccaa cgtgccagaa ggtctgctgg      1200
     ccactgtcac ggtctgtctg acactcactg ccaagcgcat ggcgaggaag aactgcctgg      1260
     tgaagaactt ggaagctgtg gagaccttgg ggtccacatc taccatctgc tcagacaaga      1320
     cgggaactct gactcagaac cggatgacag tggcccacat gtggtttgac aatcagatcc      1380
     atgaagctga caccacggag aatcagagtg gtgtctcctt tgacaagacg tcagccacct      1440
     ggttcgctct gtccagaatt gctggtctct gtaacagggc agtgtttcag gctaaccaag      1500
     aaaacctgcc tattcttaag cgggcagtag cgggagatgc ctctgagtcg gcgctcttaa      1560
     agtgcattga agtctgctgc ggctccgtga tggagatgag ggagaaatac agcaagatag      1620
     tggagattcc cttcaactcc accaacaagt accagttgtc cattcacaag aacccaaatg      1680
     catctgagcc caaacacctg ctagtgatga agggcgcccc agaaaggatc ctggaccgct      1740
     gcagctccat ccttctccac ggcaaggagc agccactgga tgaagagctg aaggacgctt      1800
     ttcagaacgc ctacctagag ctggggggcc ttggagaacg tgtgctaggt ttctgccacc      1860
     tcctcctgcc tgacgaacag tttcccgaag gcttccagtt tgacactgac gatgtcaatt      1920
     tccccgtgga taacctctgc ttcgtgggtc ttatctccat gattgaccct ccccgagctg      1980
     ctgtccccga tgctgtgggc aaatgccgca gcgctgggat taaggtcatc atggttacag      2040
     gagaccatcc aatcacagcg aaagccattg ccaagggggt aggcattatc tcagaaggca      2100
     atgagactgt ggaagacatt gctgcccgcc tcaacattcc agtgaaccag gtgaacccca      2160
     gagatgccaa ggcctgtgtg gtccacggca gtgacctgaa ggacatgacc tccgaggagc      2220
     tggatgacat cttgcggtac cacacagaga tcgtctttgc caggacctct cctcagcaga      2280
     agctcatcat tgtggagggc tgccagcggc agggcgccat cgtggccgtc acaggggatg      2340
     gtgtcaatga ctctccagct ttgaaaaagg cagatattgg ggttgccatg gggattgttg      2400
     gctctgatgt gtccaagcaa gctgctgaca tgatccttct ggatgacaac tttgcctcca      2460
     ttgtgactgg agtagaggaa ggtcgtctga tttttgataa cttgaagaaa tccatcgctt      2520
     acaccctaac cagtaacatt ccggaaatca cccccttctt gatatttatt attgcaaaca      2580
     ttccactgcc cctggggact gtgaccatcc tctgcattga cttgggcact gacatggttc      2640
     ctgccatctc cctggcctac gagcaagctg agagcgacat catgaagagg cagcccagaa      2700
     accccaaaac ggacaaactt gtgaacgagc gtctgatcag catggcctat ggacagatcg      2760
     gtatgatcca ggccctggga ggcttcttca cttactttgt gattctggct gagaacggtt      2820
     tcctgccctt tcacctgttg ggcatccgag agacctggga tgaccgctgg gtcaacgatg      2880
     tggaggacag ctacgggcag cagtggacct acgagcagag gaagatcgtg gagttcacct      2940
     gccatacagc gttctttgtc agtattgtgg tagtgcagtg ggccgacttg gtcatctgca      3000
     agaccagaag gaattctgtc ttccagcagg gaatgaagaa caagatcttg atatttggcc      3060
     tctttgaaga gacagccctt gctgctttct tatcctactg ccccgggatg ggggcagccc      3120
     ttaggatgta tcccctcaaa cctacatggt ggttctgtgc cttcccctac tcccttctca      3180
     tctttgtgta tgacgaggtg cggaagctca ttatcaggcg gcgccctggc ggctgggtgg      3240
     agaaggaaac ctactactag cccactgccc tgcacgccgt ggaacattgt gccacacact      3300
     gcacccaccc ctaccccctc tttgtgtact tcaagtcttg gagctcggaa ctctaccctg      3360
     gtaggaaagc accaaagcat gtggggatgc agacgtcctg gaatgaagca tgtagctgta      3420
     acggggggcg gggcgggggg gagggctgcc tgagaaacac cgtgtacggg gacgacagcg      3480
     ggcaaggttt atacgtgcct ttttgttttt gtaaaaaagg aaaacctgga aagactgaaa      3540
     gattacgttt tatatctgga tttttacaaa taaagatggc tattataacg gaaaaaaaaa      3600
     aaaaaaaaaa aa                                                          3612
//