Dbfetch

ID   BC023693; SV 1; linear; mRNA; STD; MUS; 3273 BP.
XX
AC   BC023693;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus gamma-aminobutyric acid (GABA-A) receptor, pi, mRNA (cDNA
DE   clone MGC:38355 IMAGE:5344479), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3273
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3273
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 18e03713220323c99bf3abf1ed5de5c3.
DR   Ensembl-Gn; ENSMUSG00000020159; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018145; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018118; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018082; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018087; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017900; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018541; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017464; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017873; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017977; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018001; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018580; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017245; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017513; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020366; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028516; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0028263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028961; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027910; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028318; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028299; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0028429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028283; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028993; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027615; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027763; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: c Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981871.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3273
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:38355 IMAGE:5344479"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3273
FT                   /gene="Gabrp"
FT                   /note="synonym: MGC38123"
FT   misc_difference 5
FT                   /gene="Gabrp"
FT                   /note="'G' in cDNA is 'T' in the mouse genome."
FT   misc_difference 7..9
FT                   /gene="Gabrp"
FT                   /note="in the mouse genome : CAT."
FT   misc_difference 13^14
FT                   /gene="Gabrp"
FT                   /note="2 bases in the mouse genome, GA, are not found in
FT                   cDNA."
FT   CDS             186..1508
FT                   /codon_start=1
FT                   /gene="Gabrp"
FT                   /product="gamma-aminobutyric acid (GABA-A) receptor, pi"
FT                   /db_xref="GOA:Q8QZW7"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008100"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:2387597"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW7"
FT                   /protein_id="AAH23693.1"
FT                   /translation="MSYSLYLAFLCLSLLTQRTCIQGNQVNVEVSRSDKLSLPGFENLT
FT                   AGYNKFLRPNFGGDPVRIALTLDIASISSISESNMDYTATIYLRQRWTDPRLVFEGNKS
FT                   FTLDARLVEFLWVPDTYIVESKKSFLHEVTVGNRLIRLFSNGTVLYALRITTTVTCNMD
FT                   LSKYPMDTQTCKLQLESWGYDGNDVEFSWLRGNDSVRGLENLRLAQYTIQQYFTLVTVS
FT                   QQETGNYTRLVLQFELRRNVLYFILETYVPSTFLVVLSWVSFWISLDSVPARTCIGVTT
FT                   VLSMTTLMIGSRTSLPNTNCFIKAIDVYLGICFSFVFGALLEYAVAHYSSLQQMAVKDR
FT                   GPAKDSEEVNITNIINSSISSFKRKISFASIEISGDNVNYSDLTMKASDKFKFVFREKI
FT                   SRIIDYFTIQNPSNVDRYSKLLFPLIFMLANVFYWAYYMYF"
FT   misc_difference 338
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2902
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2913
FT                   /gene="Gabrp"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 3030
FT                   /gene="Gabrp"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 3032..3039
FT                   /gene="Gabrp"
FT                   /note="8 bases in cDNA are not found in the mouse genome."
FT   misc_difference 3174
FT                   /gene="Gabrp"
FT                   /note="'A' in cDNA is 'T' in the mouse genome."
FT   misc_difference 3180
FT                   /gene="Gabrp"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 3201..3273
FT                   /gene="Gabrp"
FT                   /note="polyA tail: 73 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3273 BP; 906 A; 768 C; 674 G; 925 T; 0 other;
     ccacgcgtcc ggactgggtg catacttaac acccaaagag tcaggactga gatgaaaagg        60
     accctggaga cccaaaagag tatgctctgt gtgagagtcc tgcctgagat ctggaaacac       120
     ctgctgtaac agctgcctgg tgattcctcc ttcaaccttt ttgtgtgtga atcagctcct       180
     tcaacatgag ctacagcctc tatttggcct tcctgtgtct gagtctcctc actcagagga       240
     cgtgcatcca ggggaaccag gtcaatgtgg aggtcagcag aagtgacaag ctttccttac       300
     ctggctttga gaacctcact gcaggatata acaaatttct caggcccaat ttcggtggtg       360
     acccagttcg gatagcactg actctggaca tcgccagcat ctctagcatc tcagagagta       420
     acatggacta cacagccact atatacctcc ggcagcgttg gacagaccca cggctagtgt       480
     tcgaaggcaa caagagcttt actctagatg cccgccttgt ggagttcctc tgggtgccag       540
     acacttacat tgtagagtcc aagaagtcct tcctccatga agtcacagtg ggaaacaggc       600
     tcatccgcct cttctccaac ggcacagtcc tgtacgcact tagaatcaca acaacagtta       660
     catgtaacat ggatctgtct aaatacccca tggacacaca gacctgcaag ctgcagctag       720
     aaagttgggg atacgatggc aatgatgtgg agttctcctg gctgagaggg aatgactcgg       780
     tgcgtggact tgaaaacctg cgccttgctc agtacacaat ccaacagtat ttcaccctgg       840
     tcaccgtatc ccagcaggag acaggaaact atacgagatt ggttttgcaa tttgagcttc       900
     ggaggaacgt cctgtatttc attctggaaa cctatgtccc ttccaccttc ctggtggtgt       960
     tatcctgggt ctccttttgg atctccctcg attcagttcc tgcgagaacc tgcattggag      1020
     tgacaacggt gttatccatg acaacgctga tgatcggctc ccgcacatcc ctacccaaca      1080
     ccaactgctt cataaaggcc atcgatgtgt acctaggcat ctgcttcagc ttcgtgtttg      1140
     gggccttact ggagtatgca gttgctcact acagctcctt acagcagatg gcagtcaaag      1200
     atagggggcc agcgaaggac tcggaagaag tcaatatcac caacatcatc aacagctcca      1260
     tctccagctt taaacggaag attagctttg ccagcattga aatctctggt gacaatgtca      1320
     actatagtga cttgacaatg aaagccagcg acaagtttaa gtttgtcttc cgagagaaga      1380
     tcagcagaat cattgattat ttcacaattc aaaaccccag caatgtggat cgatactcca      1440
     aactactatt tcctttgatt tttatgttgg ccaatgtatt ttactgggca tactacatgt      1500
     atttttgaga cgccattgaa ctcttgcatc acataatgag gttaagggta ttctagaaca      1560
     tgtgtgtgca cttcagctta gaaagctaca aatgggctaa tgtaacaatt attctaagtt      1620
     gtgtagaagc cctagtgtga ccagattcta taatagagtc attataaggc aacccttttc      1680
     ttcttcaatt ttggacagaa caccccctcc acacacatac acagaaccca agactgcgaa      1740
     cctactcagg gctatttgct ctctggatcc ctggtctgca ttcactccat aaaaatgtgg      1800
     gaagatgatt acatatatta aggggtttat tttctaaaga attcatagtg ccactgatta      1860
     catctctgtg gcccttataa tatgctctct tgcctattta aacaccagtg ttttctaatt      1920
     tttgtttttc cttgaaatat gaaatgtggg tttgcgtcaa ttcattggtg gttaccttgc      1980
     ctcatcaacc taataccaga tgggttctta gtgttattta ataccacaga agaattgtcc      2040
     ccaaattcta atacatccta ttattcacaa atcagatgta aatgaataaa attagtggat      2100
     caataaacta aaagaaaaaa acataaatcc tttggggtcc agggcttcat gccgtttttc      2160
     cacgtatctt attattttgt ttttatacac cttagtccta acctatgtaa aaaccccttt      2220
     tccacatcag gaaaacggga ggaagttttg aaacttgttc tggattccta atacagaatg      2280
     cgtccatgaa gacttgctga gtcaagtgta ctagctagcc acctttactc acatactggc      2340
     taggaaccaa gtagaccaga gagtgctctg tcaacctgtc ctctctgctg acctgttgac      2400
     caagatgctg gggaacattt tgccggtggc aaaggccctg cctccttcaa agaggagctt      2460
     ttatccctgt gctccagtga ctaggcagga gtgatgtcta ttagataaga agcggcacta      2520
     ctgggacaca agtagcttat cttaaatagt taccttttcc caacctttct agctggacta      2580
     ctttgagtgg attaccctgc ctgagcagca gaccactggc cctgactggt tccgactgtt      2640
     ctgaacgatg gaaagacaca ttgcacaacc cacgtgagct gtcttttctg agttcagcca      2700
     gggtcaccct gacctaggag ctcttgtgtg ccctctctct ctcttgctcc acgggaatcg      2760
     cctatataag gttccaatgc agcctcaatt gtttcaaaga ctcttgctgt cttcaggtct      2820
     ttcccttcct tttctaatga accctcagct ttccctgtcc tttctacaac aaaccggggc      2880
     tgtagatgtt ctttcctttc atgtccttca cctacgggcc ctccttttca tcagcatggc      2940
     tctgcccatc gttccgtttc tgtgagcttg agtgcctggc gcttaacaga tgtttctatt      3000
     ttaggattcg ctttgttcat tggagtacac tcttaagcta ggtgtagttg cgccattaga      3060
     gttcttagta gaatctcttt gtattttgta tctgtcatat acattcctaa ggggaggggc      3120
     taggggaggg gaagtgtggt tgagtgagta ggtcatacct gtgcattttt tttaaaaaaa      3180
     taaaaatgtt taaaatataa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa      3240
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaa                                   3273
//