spacer

EBI Dbfetch

ID   BC023690; SV 1; linear; mRNA; STD; MUS; 2041 BP.
XX
AC   BC023690;
XX
DT   24-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 8)
XX
DE   Mus musculus 5-hydroxytryptamine (serotonin) receptor 2B, mRNA (cDNA clone
DE   MGC:36132 IMAGE:5344328), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2041
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2041
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 7ab5177f40d319add48157720f8b8476.
DR   Ensembl-Gn; ENSMUSG00000026228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027431; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: National Institutes of Health Intramural
CC   Sequencing Center (NISC),
CC   Gaithersburg, Maryland;
CC   Web site: http://www.nisc.nih.gov/
CC   Contact: nisc_mgc@nhgri.nih.gov
CC   Akhter,N., Ayele,K., Beckstrom-Sternberg,S.M., Benjamin,B.,
CC   Blakesley,R.W., Bouffard,G.G., Breen,K., Brinkley,C., Brooks,S.,
CC   Dietrich,N.L., Granite,S., Guan,X., Gupta,J., Haghighi,P.,
CC   Hansen,N., Ho,S.-L., Karlins,E., Kwong,P., Laric,P., Legaspi,R.,
CC   Maduro,Q.L., Masiello,C., Maskeri,B., Mastrian,S.D.,McCloskey,J.C.,
CC   McDowell,J., Pearson,R., Stantripop,S., Thomas,P.J., Touchman,J.W.,
CC   Tsurgeon,C., Vogt,J.L., Walker,M.A., Wetherby,K.D., Wiggins,L.,
CC   Young,A., Zhang,L.-H. and Green,E.D.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 55 Row: c Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680322.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2041
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:36132 IMAGE:5344328"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2041
FT                   /gene="Htr2b"
FT                   /note="synonym: 5-HT2B"
FT   misc_difference 1
FT                   /gene="Htr2b"
FT                   /note="1 base at the 5' end does not align to the mouse
FT                   genome."
FT   misc_difference 5..6
FT                   /gene="Htr2b"
FT                   /note="in the mouse genome : AG."
FT   misc_difference 8
FT                   /gene="Htr2b"
FT                   /note="'T' in cDNA is 'A' in the mouse genome."
FT   misc_difference 10..11
FT                   /gene="Htr2b"
FT                   /note="2 bases in cDNA are not found in the mouse genome."
FT   misc_difference 183
FT                   /gene="Htr2b"
FT                   /note="'G' in cDNA is 'A' in the mouse genome."
FT   CDS             277..1716
FT                   /codon_start=1
FT                   /gene="Htr2b"
FT                   /product="5-hydroxytryptamine (serotonin) receptor 2B"
FT                   /db_xref="GOA:Q02152"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000482"
FT                   /db_xref="InterPro:IPR002231"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:109323"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02152"
FT                   /protein_id="AAH23690.1"
FT                   /translation="MASSYKMSEQSTTSEHILQKTCDHLILTNRSGLETDSVAEEMKQT
FT                   VEGQGHTVHWAALLILAVIIPTIGGNILVILAVALEKRLQYATNYFLMSLAIADLLVGL
FT                   FVMPIALLTIMFEAIWPLPLALCPAWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQAN
FT                   QCNSRATAFIKITVVWLISIGIAIPVPIKGIETDVINPHNVTCELTKDRFGSFMVFGSL
FT                   AAFFAPLTIMVVTYFLTIHTLQKKAYLVKNKPPQRLTRWTVPTVFLREDSSFSSPEKVA
FT                   MLDGSHRDKILPNSSDETLMRRMSSVGKRSAQTISNEQRASKALGVVFFLFLLMWCPFF
FT                   ITNLTLALCDSCNQTTLKTLLEIFVWIGYVSSGVNPLIYTLFNKTFREAFGRYITCNYR
FT                   ATKSVKALRKFSSTLCFGNSMVENSKFFTKHGIRNGINPAMYQSPMRLRSSTIQSSSII
FT                   LLDTLLTENDGDKAEEQVSYI"
FT   misc_difference 1768
FT                   /gene="Htr2b"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 2034..2041
FT                   /gene="Htr2b"
FT                   /note="polyA tail: 8 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2041 BP; 590 A; 477 C; 430 G; 544 T; 0 other;
     ccacgcgtcc gggctggctt aggaagccac agaagacaag cgtcttctgg aatctaagcc        60
     tctagaaaat ctaaaatgtg gatgtcttac ctgcaaacac ggacagacgt gtacacagtc       120
     ccatcttcga gagcctgaat ctttttagaa ggaagaagtc accttggctg tgagtgtctg       180
     gtgggtttgc taaatgcttt gctaaagcag atgacttgct tagctactga ccatgctgac       240
     cactgtctgg aactggactg agtcaccaaa aggcgaatgg cttcatctta taaaatgtct       300
     gaacaaagca caacttctga gcacatttta cagaagacat gtgatcacct gatcctgact       360
     aaccgttctg gattagagac agactcagta gcagaggaaa tgaagcagac tgtggaggga       420
     caggggcata cagtgcactg ggcagctctc ctgatactcg cggtgataat acccaccatt       480
     ggtgggaaca tccttgtgat tctggctgtt gcactggaga aaaggctgca gtacgctacc       540
     aactactttt taatgtcctt ggcgatagca gatttgctgg ttggattgtt tgtgatgccg       600
     attgccctct tgacaatcat gtttgaggct atatggcccc tcccactggc cctgtgtcct       660
     gcctggttat tcctcgatgt tctcttttca actgcctcca tcatgcatct ctgtgccatt       720
     tccctggacc gctatatagc catcaaaaag ccaattcagg ccaatcagtg caactcccgg       780
     gctactgcat tcatcaagat tacagtggta tggttaattt caataggcat cgccatccca       840
     gtccctatta aaggaatcga gactgatgtg attaatccac acaatgtcac ctgtgagctg       900
     acaaaggacc gctttggcag ttttatggtc tttgggtcac tggctgcttt cttcgcacct       960
     ctcaccatca tggtagtcac ttactttctc accattcaca ctttacagaa gaaagcttac      1020
     ttggtcaaaa ataagccacc tcaacgccta acacggtgga ctgtgcccac agttttccta      1080
     agggaagact catccttttc atcaccagaa aaggtggcaa tgctggatgg gtctcacagg      1140
     gataaaattc tacctaactc aagtgatgag acacttatgc gaagaatgtc ctcagttgga      1200
     aaaagatcag cccaaaccat ttctaatgag cagagagcct cgaaggccct tggagtcgtg      1260
     tttttccttt ttctgcttat gtggtgcccc ttttttatta caaatctaac tttagctctg      1320
     tgtgattcct gcaatcagac cactctcaaa acactcctgg agatatttgt gtggataggc      1380
     tacgtttcct cgggggtgaa tcctctgatc tatacactct tcaataagac atttcgggaa      1440
     gcatttggca ggtacatcac ctgcaattac cgagccacaa agtcagtaaa agcacttagg      1500
     aagttttcca gtacactttg ttttgggaat tcaatggtag aaaactctaa atttttcaca      1560
     aaacatggaa ttcgaaatgg gatcaaccct gccatgtacc agagcccaat gaggctccga      1620
     agttcaacca ttcagtcctc atcaatcatc ctcctcgata cccttctcac tgaaaacgat      1680
     ggcgacaaag cggaagagca ggtcagctac atatagcaga acgggccgcc ctcatctgag      1740
     agaggtgatg agcaggacgc acgcgcacca tggaaaggta cagagtgaat gaaaacccca      1800
     ccctctcctg agtgaagtac caaggctgtc cagcttcctt atctaaacaa actcaagcat      1860
     ggctaaagta gatctgatgg cttcaaacaa acgcaatctc tactctggtt ttcaaataca      1920
     attaaataag ttgataaatt tcagtctttt aaaaaaaaag aatgtcaaca aatttttaag      1980
     tttctaatgt gtgtaaagtt gtgttaagaa agaaataaaa tgaaacaaaa aaaaaaaaaa      2040
     a                                                                      2041
//


spacer
spacer