spacer

EBI Dbfetch

ID   BC023420; SV 1; linear; mRNA; STD; MUS; 1312 BP.
XX
AC   BC023420;
XX
DT   17-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus natriuretic peptide receptor 2, mRNA (cDNA clone
DE   IMAGE:5052434), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1312
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1312
RA   Strausberg R.;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; df13ab5c19e9594db4bfbb7153add63a.
DR   Ensembl-Gn; ENSMUSG00000028469; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128549; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 45 Row: m Column: 10
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1312
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="IMAGE:5052434"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1312
FT                   /gene="Npr2"
FT   CDS             <1..1035
FT                   /codon_start=1
FT                   /gene="Npr2"
FT                   /product="Npr2 protein"
FT                   /db_xref="GOA:Q8R1P8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR011645"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="MGI:MGI:97372"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R1P8"
FT                   /protein_id="AAH23420.1"
FT                   /translation="KADVYSFAIILQEIALRSGPFYLEGLDLSPKEIVQKVRNGQRPYF
FT                   RPSIDRTQLNEELVLLMERCWAQDPTERPDFGQIKGFIRRFNKEGGTSILDNLLLRMEQ
FT                   YANNLEKLVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSD
FT                   IVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPGRNGQR
FT                   HAPEIARMALALLDAVSSFRIRHRPHDQLRLRIGVHTGPVCAGVVGLKMPRYCLFGDTV
FT                   NTASRMESNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTYWLLGEQKGP
FT                   PGLL"
FT   misc_feature    1..249
FT                   /gene="Npr2"
FT                   /note="TyrKc; Region: Tyrosine kinase, catalytic domain"
FT   misc_feature    364..918
FT                   /gene="Npr2"
FT                   /note="CYCc; Region: Adenylyl- / guanylyl cyclase,
FT                   catalytic domain"
XX
SQ   Sequence 1312 BP; 351 A; 338 C; 330 G; 293 T; 0 other;
     aaagcagatg tctacagctt tgccatcatt ctacaggaaa tagcacttcg aagtggtcct        60
     ttctacttgg aaggcctgga cctcagtccc aaggagattg tccagaaggt gcggaatggt       120
     cagaggccgt atttccggcc aagcattgac cggacacaac tgaatgaaga gttagttttg       180
     ctgatggaga gatgctgggc ccaggaccca acagaacgtc cagactttgg gcaaatcaag       240
     ggcttcattc gccggtttaa caaggaaggt ggtaccagca tattggacaa cctcttgctg       300
     cgcatggaac agtatgctaa taacctggaa aagctggtgg aggaacgcac acaggcctat       360
     ctagaggaga aacgcaaagc agaggccctg ctgtaccaaa ttctacccca ttctgtagca       420
     gagcagttaa agcggggaga gacggttcag gcggaggcct tcgacagcgt caccatctac       480
     ttcagtgaca tcgtgggctt cacagcgctg tcagctgaga gcacccccat gcaggtggtg       540
     acacttctta atgaccttta tacctgcttt gatgccatta tcgacaactt tgatgtctac       600
     aaggtggaaa ccattgggga tgcctacatg gtggtatctg gccttccagg ccgaaacggt       660
     cagcgccatg caccagaaat tgctcgaatg gccctagcat tgctagatgc tgtctcttcc       720
     ttccgcatcc gccatcgacc ccatgaccag ctgaggttac gcataggtgt ccatactggg       780
     ccagtctgtg ctggggtggt tggcctgaag atgccccggt actgtctttt tggagacaca       840
     gtaaacactg cttctcgaat ggagtcgaat ggccaagctc taaagatcca tgtctcctcg       900
     accaccaagg acgccctgga tgagctggga tgcttccagc tcgagctccg tggggatgtg       960
     gagatgaagg gaaaaggaaa aatgcgaact tactggctct tgggagagca aaagggacct      1020
     cccggactcc tgtaaagccc aggccggcca tcttctgctg ctggtacttg gatgggcaat      1080
     ggtcactgtg tttccacaca gcaaaaacag acgtagccat atcagatgga aaacatgcac      1140
     agacacaaac cccctgcctt atgtggaaat catagccccc tgccgctcag ccttgtacat      1200
     agacctatcc ctccctgccc tggtcctctt cctgcctcct gtaaatatct gtatctagac      1260
     cagaatattt tgtccaagta taaaacaaca acaaaaaaaa aaaaaaaaaa aa              1312
//


spacer
spacer