Dbfetch

ID   BC023397; SV 1; linear; mRNA; STD; MUS; 2138 BP.
XX
AC   BC023397;
XX
DT   18-MAR-2002 (Rel. 71, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus limb region 1 like, mRNA (cDNA clone MGC:32459 IMAGE:5043877),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2138
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2138
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 3a13ed42c804a8c1ee7dba2c41bfc3af.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 45 Row: l Column: 14
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981312.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2138
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Kid14"
FT                   /clone="MGC:32459 IMAGE:5043877"
FT                   /tissue_type="Kidney, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2138
FT                   /gene="Lmbr1l"
FT                   /note="synonym: Limr"
FT   CDS             115..1584
FT                   /codon_start=1
FT                   /gene="Lmbr1l"
FT                   /product="limb region 1 like"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="AAH23397.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
FT   misc_difference 2109..2138
FT                   /gene="Lmbr1l"
FT                   /note="polyA tail: 30 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2138 BP; 415 A; 606 C; 596 G; 521 T; 0 other;
     gcgaggagag gcgcttaggc tgggtccggg tgcttggcgg gcggcggcgg cctcatcccc        60
     gctcgtcctc cccgggcccg gagacacccc cgccccagtc atgctgagca gagtatggaa       120
     gcagctgact acgaagtgct atccgtgcga gaacagctgt tccacgacag ggtccgcgag       180
     tgcatcatct caatacttct gtttgcaaca ctctacatcc tctgccatat cttcctgacc       240
     cgcttcaaga agcctgctga gttcaccaca gtggatgatg aagatgccac agttaacaag       300
     attgcgctgg agctgtgcac ctttaccctg gcggtcgccc tgggcgccgt cttactcctg       360
     cccttctcca tcatcagcaa cgaggtgctg ctctcgttgc cacgcaacta ctacatccag       420
     tggctcaatg gctccctcat ccatggtctg tggaacctcg ttttcctctt ctccaatctg       480
     tccctcgtct tccttatgcc ctttgcatat ttcttcacag agtctgaagg ctttgctggc       540
     tccagaaagg gtgtcctggg ccgggtctac gagacagtgg tgatgttgat cctcctcacg       600
     ctgcttgtgc tgggcatggt gtgggtggca tccgccattg tagacaatga caaggccagc       660
     agggagtcgc tctacgactt ctgggagtac tacctcccct atctctactc ctgtatctcc       720
     ttcctcggag ttctgctgct tctggtgtgc actccactag gtctcgcccg catgttctct       780
     gtcactggga agttgctggt caagccccgg ctactggaag acctggagga acagctgaac       840
     tgctcagcct ttgaggaggc agctctgact cgaagaatct gcaatcccac ctcctgctgg       900
     ctgccactgg acatggaact gctgcataga caggtcctgg ctctgcaggc acagagggtc       960
     ctcttggaaa agcgtcggaa ggcgtcagcc tggcaacgga acctgggcta ccctctggcc      1020
     atgctgtgct tgctggtgct gacgggcctg tctgtcctca tcgtggctgt ccacatcctg      1080
     gagctgctta ttgacgaggc tgccatgcca cggggcatgc aggatgctgc cctaggccag      1140
     gcctccttct ccaaactggg atcctttggc gccatcatcc aggttgtgct gatattttac      1200
     ctgatggtgt cctcagtggt gggtttctac agctctccac tctttggaag cctgaggcct      1260
     aggtggcatg acacatcgat gacacagatc attgggaact gtgtctgcct cctggtcctc      1320
     agctcagcac ttcctgtctt ctctagaact cttggcctga cacgctttga cctgctgggt      1380
     gactttggac gcttcaactg gctaggcaat ttctacatcg tgttcctcta caacgcagcc      1440
     tttgctggcc tcaccacact ctgtctggtg aagaccttca cggcagctgt gagggcagag      1500
     ctgatccgag cctttgggct ggacagactg ccactgcctg tctctgggtt tccccgggct      1560
     tctaggaaga agcagcatca atgacctcca gctgggggct gagaaggaga gaactgggca      1620
     gtgcctaggc ctggcggtga gccccagggg gctgcacctc aggacctgga acctgagagt      1680
     aggtgacaga ggggacggac catctgcact gttgcttaat ctgagccaga gtttgggacc      1740
     cggctggcct cctgcctttt cagatgtagc tgtggcctga gcatccatct ggtggagctg      1800
     ggggactcgc tctagttcct ggacccaaat acgtttacac atctatctgc ctcaatcctg      1860
     ttccaggcca tgcctgaagc catgtttaca tgatttgatg tgcaataggg tgggtgggac      1920
     ttggggggac tgggccaggg gtaggttctg gagacaggtc ttccttgcct ctggcccaga      1980
     agagccgaag cactgtgcta tcctgtggag ggctttggac cactggagag accaagggtg      2040
     ctgggaggag gcggctgcac ccacgagcaa taaaattgat cccagggttt tcttggttct      2100
     tttgtaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaa                              2138
//