Dbfetch

ID   BC023114; SV 1; linear; mRNA; STD; MUS; 2810 BP.
XX
AC   BC023114;
XX
DT   08-FEB-2002 (Rel. 70, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus solute carrier family 27 (fatty acid transporter), member 4,
DE   mRNA (cDNA clone MGC:28448 IMAGE:4158956), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2810
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2810
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 47817ed98d68a440e71b7e909dae24a6.
DR   Ensembl-Gn; ENSMUSG00000059316; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025544; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025522; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025491; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025517; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025279; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025962; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024742; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025352; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025475; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0026021; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024810; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080065; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0053664; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0053678; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0053632; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053621; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0053356; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054113; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0053522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0053301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0053410; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0053372; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0053518; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0053357; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0054249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0053124; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0052633; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 37 Row: c Column: 3
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 45597452.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2810
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:28448 IMAGE:4158956"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2810
FT                   /gene="Slc27a4"
FT                   /note="synonym: FATP4"
FT   CDS             139..2070
FT                   /codon_start=1
FT                   /gene="Slc27a4"
FT                   /product="solute carrier family 27 (fatty acid
FT                   transporter), member 4"
FT                   /db_xref="GOA:Q91VE0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR030304"
FT                   /db_xref="MGI:MGI:1347347"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VE0"
FT                   /protein_id="AAH23114.1"
FT                   /translation="MLLGASLVGALLFSKLVLKLPWTQVGFSLLLLYLGSGGWRFIRVF
FT                   IKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTF
FT                   RQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRD
FT                   ALRHCLDTSKARALIFGSEMASAICEIHASLEPTLSLFCSGSWEPSTVPVSTEHLDPLL
FT                   EDAPKHLPSHPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDI
FT                   VYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRY
FT                   LLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSR
FT                   VGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLR
FT                   RFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVS
FT                   TTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLY
FT                   ARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTR
FT                   IQAGEEKL"
FT   misc_difference 2794..2810
FT                   /gene="Slc27a4"
FT                   /note="polyA tail: 17 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2810 BP; 579 A; 812 C; 804 G; 615 T; 0 other;
     gaggagtggg ccagacgcac cgaggctcgg ctgtgtgtgc cccggggcgg ccgatgcccc        60
     cagcgcaccg cactccgctg ccgcaaccgg gccgcatcct gacggggcgc cgcgccgcgc       120
     agccgcagcc gggtcacaat gctacttgga gcatctctgg tgggggcgct actgttctcc       180
     aagctagtgc tgaagctgcc ctggacccag gtgggattct ccctgttgct cctgtacttg       240
     gggtctggtg gctggcgttt catccgggtc ttcatcaaga cggtcaggag agatatcttt       300
     ggtggcatgg tgctcctgaa ggtgaagacc aaggtgcgac ggtaccttca ggagcggaag       360
     acggtgcccc tgctgtttgc ttcaatggta cagcgccacc cggacaagac agccctgatt       420
     ttcgagggca cagacactca ctggaccttc cgccagctgg atgagtactc cagtagtgtg       480
     gccaacttcc tgcaggcccg gggcctggcc tcaggcaatg tagttgccct ctttatggaa       540
     aaccgcaatg agtttgtggg tctgtggcta ggcatggcca agctgggcgt ggaggcggct       600
     ctcatcaaca ccaaccttag gcgggatgcc ctgcgccact gtcttgacac ctcaaaggca       660
     cgagctctca tctttggcag tgagatggcc tcagctatct gtgagatcca tgctagcctg       720
     gagcccacac tcagcctctt ctgctctgga tcctgggagc ccagcacagt gcccgtcagc       780
     acagagcatc tggaccctct tctggaagat gccccgaagc acctgcccag tcacccagac       840
     aagggtttta cagataagct cttctacatc tacacatcgg gcaccacggg gctacccaaa       900
     gctgccattg tggtgcacag caggtattat cgtatggctt ccctggtgta ctatggattc       960
     cgcatgcggc ctgatgacat tgtctatgac tgcctccccc tctaccactc agcaggaaac      1020
     atcgtgggga ttggccagtg cttactccac ggcatgactg tggtgatccg gaagaagttc      1080
     tcagcctccc ggttctggga tgattgtatc aagtacaact gcacaattgt acagtacatt      1140
     ggcgagctct gccgctacct cctgaaccag ccaccccgtg aggctgagtc tcggcacaag      1200
     gtgcgcatgg cactgggcaa cggtctccgg cagtccatct ggaccgactt ctccagccgt      1260
     ttccacatcc cccaggtggc tgagttctat ggggccactg aatgcaactg tagcctgggc      1320
     aactttgaca gccgggtggg ggcctgtggc ttcaatagcc gcatcctgtc ctttgtgtac      1380
     cctatccgtt tggtacgtgt caatgaggat accatggaac tgatccgggg acccgatgga      1440
     gtctgcattc cctgtcaacc aggtcagcca ggccagctgg tgggtcgcat catccagcag      1500
     gaccctctgc gccgtttcga cgggtacctc aaccagggtg ccaacaacaa gaagattgct      1560
     aatgatgtct tcaagaaggg ggaccaagcc tacctcactg gtgacgtcct ggtgatggat      1620
     gagctgggtt acctgtactt ccgagatcgc actggggaca cgttccgctg gaaaggggag      1680
     aatgtatcta ccactgaggt ggagggcaca ctcagccgcc tgcttcatat ggcagatgtg      1740
     gcagtttatg gtgttgaggt gccaggaact gaaggccgag caggaatggc tgccgttgca      1800
     agtcccatca gcaactgtga cctggagagc tttgcacaga ccttgaaaaa ggagctgcct      1860
     ctgtatgccc gccccatctt cctgcgcttc ttgcctgagc tgcacaagac agggaccttc      1920
     aagttccaga agacagagtt gcggaaggag ggctttgacc catctgttgt gaaagacccg      1980
     ctgttctatc tggatgctcg gaagggctgc tacgttgcac tggaccagga ggcctatacc      2040
     cgcatccagg caggcgagga gaagctgtga tttcccccta catccctctg agggccagaa      2100
     gatgctggat tcagagccct agcgtccacc ccagaggggt cctgggcaat gccagaccaa      2160
     agctagcagg gcccgcacct ccgcccctag gtgctgatct cccctctccc aaactgccaa      2220
     gtgactcact gccgcttccc cgaccctcca gaggctttct gtgaaagtct catccaagct      2280
     gtgtcttctg gtccaggcgt ggcccctggc cccagggttt ctgataggct cctttaggat      2340
     ggtatcttgg gtccagcggg ccagggtgtg ggagaggagt cactaagatc cctccaatca      2400
     gaagggagct tacaaaggaa ccaaggcaaa gcctgtagac tcaggaagct aagtggccag      2460
     agactatagt ggccagtcat cccatgtcca cagaggatct tggtccagag ctgccaaagt      2520
     gtcacctctc cctgcctgca cctctgggga aaagaggaca gcatgtggcc actgggcacc      2580
     tgtctcaaga agtcaggatc acacactcag tccttgtttc tccaggttcc cttgttcttg      2640
     tctcggggag ggagggacga gtgtcctgtc tgtccttcct gcctgtctgt gagtctgtgt      2700
     tgcttctcca tctgtcctag cctgagtgtg ggtggaacag gcatgaggag agtgtggctc      2760
     aggggccaat aaactctgcc ttgactcctc ttaaaaaaaa aaaaaaaaaa                 2810
//