spacer

EBI Dbfetch

ID   BC023060; SV 1; linear; mRNA; STD; MUS; 1004 BP.
XX
AC   BC023060;
XX
DT   08-FEB-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus epidermal growth factor-containing fibulin-like extracellular
DE   matrix protein 1, mRNA (cDNA clone IMAGE:5357328), partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1004
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1004
RA   Strausberg R.;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   Ensembl-Gn; ENSMUSG00000020467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020759; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 54 Row: f Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1004
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="IMAGE:5357328"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..567
FT                   /codon_start=1
FT                   /gene="Efemp1"
FT                   /product="Efemp1 protein"
FT                   /db_xref="GOA:Q8R1U8"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="MGI:MGI:1339998"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R1U8"
FT                   /protein_id="AAH23060.1"
FT                   /translation="QYQCVNEPGKFSCMCPQGYEVVRSRTCQDINECETTNECREDEMC
FT                   WNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSNTMCRELPQSIVYKYMSIRSDRSVPSD
FT                   IFQIQATMIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEML
FT                   TVSSIGTFRTSSVLRLTIIVGPFSF"
XX
SQ   Sequence 1004 BP; 335 A; 194 C; 198 G; 277 T; 0 other;
     caatatcaat gtgtcaatga acctgggaag ttctcatgta tgtgcccaca gggttacgaa        60
     gtggtgcgca gcagaacctg tcaggatata aatgaatgtg agaccaccaa tgaatgccga       120
     gaagatgaga tgtgctggaa ttaccatggg ggcttccgct gttacccacg aaacccatgt       180
     caagatcact atgttctaac atcagaaaac cgatgtgttt gcccagtctc aaacactatg       240
     tgccgggagc tgccccagtc cattgtctac aaatacatga gcatccgatc tgacaggtcc       300
     gtgccttcag acatcttcca gatacaggca acaatgattt atgcaaacac cattaatact       360
     tttcggatta aatctggaaa tgaaaatgga gagttctacc tacgacaaac aagccctgtg       420
     agtgcaatgc tggtgcttgt gaagtctcta tcaggaccaa gagaatacat cgtggacctg       480
     gagatgctga cagtcagtag tataggaacc ttccgcacaa gctctgtgtt aagattgaca       540
     ataatagtgg ggccattttc attttagcct tttactcata taaagcctac tacaagcatt       600
     taaatcagcc aaacaatatc attaccttaa aactctattt tatttatagc tatatctagt       660
     acatgtatat tcaaatagct agactatggt aagaagtggg catttaatcc ataagagtca       720
     atgtttatcg ttatcactgt gtgtaaatta gacctttatc caacattaag agagctaatc       780
     atatattatc tagtgaaact tggattcttt cctgcaaaat gggaccaagc aaggatactg       840
     ttctgtgttg tatagagaaa tatacacctc cacagaccat cccgtgagaa ttggccatct       900
     tagcatgaag atcaagaagg agggtttttt taactgcttt gtaagaaaat ggaaaaaagt       960
     caataaagat atatttcttt agaaaatgag aaaaaaaaaa aaaa                       1004
//


spacer
spacer