Dbfetch

ID   BC023001; SV 1; linear; mRNA; STD; MUS; 1354 BP.
XX
AC   BC023001;
XX
DT   08-FEB-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 11)
XX
DE   Mus musculus regulator of G-protein signaling 2, mRNA (cDNA clone MGC:36187
DE   IMAGE:5365271), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1354
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1354
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 80d6fe10ae63c43d5eb2a8ab1219cd4f.
DR   Ensembl-Gn; ENSMUSG00000026360; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016548; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016513; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016508; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016333; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016969; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015912; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016307; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0016413; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016411; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016484; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016437; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017005; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015698; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015975; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000127206; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0022514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0022483; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0022450; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0022453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0022263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0022966; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0021791; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0022203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0022327; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0022338; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0022429; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0022306; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0023003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0021513; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0021832; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 53 Row: j Column: 17
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31543585.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1354
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:36187 IMAGE:5365271"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1354
FT                   /gene="Rgs2"
FT                   /note="synonym: GOS8"
FT   CDS             15..650
FT                   /codon_start=1
FT                   /gene="Rgs2"
FT                   /product="regulator of G-protein signaling 2"
FT                   /db_xref="GOA:O08849"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="InterPro:IPR034947"
FT                   /db_xref="MGI:MGI:1098271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08849"
FT                   /protein_id="AAH23001.1"
FT                   /translation="MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRL
FT                   SYFLQNSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSE
FT                   FCEENIEFWLACEDFKKTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQ
FT                   EATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEPHAT"
FT   misc_difference 736
FT                   /gene="Rgs2"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 1342..1354
FT                   /gene="Rgs2"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1354 BP; 418 A; 275 C; 321 G; 340 T; 0 other;
     gcgggagtct gagaatgcaa agtgccatgt tcctggctgt ccagcacgac tgcgtaccca        60
     tggacaagag tgcaggcaac ggccccaagg tcgaggagaa gcgggagaaa atgaagcgga       120
     cactcttaaa ggattggaag acccgtttga gctacttctt gcagaattcc tctgctcctg       180
     ggaagcccaa aactggcaag aaaagcaaac agcaaacttt tatcaagcct tctcctgagg       240
     aagcgcagct ctgggcagaa gcatttgatg aactgctggc cagtaaatat gggctggctg       300
     cattcagggc gtttttaaag tccgagttct gtgaagaaaa cattgaattc tggttggctt       360
     gtgaagactt caaaaaaacc aaatcacccc aaaaactgtc ctcaaaagca aggaaaatct       420
     ataccgactt catagagaag gaagctccca aagagataaa catagacttc caaacgaaat       480
     ctctgattgc ccaaaatatc caagaggcta caagtggctg cttcaccaca gctcagaaga       540
     gggtgtacag tttgatggag aacaattctt atcctcggtt cttggagtcc gaattctacc       600
     aggacttatg taaaaagcca cagatcacca cggagcccca tgctacatga gaccaggagt       660
     ccccccacac acaaaggaca ttccattctg tctcccaaga gcaaaggctg tgacctgcca       720
     gaaaaaaaaa aaaaaactga ccttgaattc agcctgagtg ttaggaaaac atcgctcaga       780
     actattgatt caatgttggg tagtgaatca ggaagtcagc aacctaggag aggctctgtg       840
     tgagaacggc ttccctcact gtgtgaagaa cagagggagg gaacaggcct ctgaatgtgt       900
     tcttcctcct tgtcgggaaa gcagagtttg agatgaaaga tccgatgcaa tgttgttgga       960
     gcatttaaaa tcaataggtc tgggattatg tggccttagc tagttggctg tacaccttcc      1020
     ctaaactagt ccatgttacc acatagtggt gttagttcta gttttaatat tttagtacta      1080
     agtaacatta caatgtttac tgtgtgcaag ggtgttgacg ttcttaggac tacagatcat      1140
     tagtactagt gtgtcacgta tcactgaaac tgagaagtat gtttgagttg ttaaatggtg      1200
     tgtgtgatgg accgaatgct gtgccgtgct gtagaaccag cgtctgttac gagtgccaaa      1260
     aactgtcttg cgggcagcta aactttgaag tggtttttga atacttttaa taaatttatt      1320
     ttgctaaata atgtcattga aaaaaaaaaa aaaa                                  1354
//