Dbfetch

ID   BC022986; SV 1; linear; mRNA; STD; MUS; 2324 BP.
XX
AC   BC022986;
XX
DT   08-FEB-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 13)
XX
DE   Mus musculus transferrin, mRNA (cDNA clone MGC:29918 IMAGE:5123741),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2324
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2324
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (04-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; aa451282b1a92a3dd1f3ca8afde8a7ed.
DR   Ensembl-Gn; ENSMUSG00000032554; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035196; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035108; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035169; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034879; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034191; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034957; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034996; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000035158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000112645; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0093929; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0094013; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0093966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0093939; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0093516; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0094453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0094114; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0093435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0093645; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0093499; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0093653; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0093475; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0094780; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0092513; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 42 Row: o Column: 12
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 20330801.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2324
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:29918 IMAGE:5123741"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2324
FT                   /gene="Trf"
FT                   /note="synonyms: Tfn, Cd176, HP"
FT   CDS             49..2142
FT                   /codon_start=1
FT                   /gene="Trf"
FT                   /product="transferrin"
FT                   /db_xref="GOA:Q921I1"
FT                   /db_xref="InterPro:IPR001156"
FT                   /db_xref="InterPro:IPR016357"
FT                   /db_xref="InterPro:IPR018195"
FT                   /db_xref="InterPro:IPR030685"
FT                   /db_xref="MGI:MGI:98821"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q921I1"
FT                   /protein_id="AAH22986.1"
FT                   /translation="MRLTVGALLACAALGLCLAVPDKTVKWCAVSEHENTKCISFRDHM
FT                   KTVLPPDGPRLACVKKTSYPDCIKAISASEADAMTLDGGWVYDAGLTPNNLKPVAAEFY
FT                   GSVEHPQTYYYAVAVVKKGTDFQLNQLEGKKSCHTGLGRSAGWVIPIGLLFCKLSEPRS
FT                   PLEKAVSSFFSGSCVPCADPVAFPKLCQLCPGCGCSSTQPFFGYVGAFKCLKDGGGDVA
FT                   FVKHTTIFEVLPEKADRDQYELLCLDNTRKPVDQYEDCYLARIPSHAVVARKNNGKEDL
FT                   IWEILKVAQEHFGKGKSKDFQLFSSPLGKDLLFKDSAFGLLRVPPRMDYRLYLGHNYVT
FT                   AIRNQQEGVCPEGSIDNSPVKWCALSHLERTKCDEWSIISEGKIECESAETTEDCIEKI
FT                   VNGEADAMTLDGGHAYIAGQCGLVPVMAEYYESSNCAIPSQQGIFPKGYYAVAVVKASD
FT                   TSITWNNLKGKKSCHTGVDRTAGWNIPMGMLYNRINHCKFDEFFSQGCAPGYEKNSTLC
FT                   DLCIGPLKCAPNNKEEYNGYTGAFRCLVEKGDVAFVKHQTVLDNTEGKNPAEWAKNLKQ
FT                   EDFELLCPDGTRKPVKDFASCHLAQAPNHVVVSRKEKAARVKAVLTSQETLFGGSDCTG
FT                   NFCLFKSTTKDLLFRDDTKCFVKLPEGTTPEKYLGAEYMQSVGNMRKCSTSRLLEACTF
FT                   HKH"
FT   misc_difference 159
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 657
FT                   /gene="Trf"
FT                   /note="'G' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1974
FT                   /gene="Trf"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2236
FT                   /gene="Trf"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2311..2324
FT                   /gene="Trf"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2324 BP; 587 A; 585 C; 629 G; 523 T; 0 other;
     gcgggtcggt ctgtactccc cgctcctcgc cacacacaca ccgagaggat gaggctcacc        60
     gtgggtgccc tgctggcctg cgctgccctg gggctgtgtc tggctgtccc tgacaaaacg       120
     gtcaaatggt gcgcagtgtc agagcacgag aataccaaat gcatcagctt ccgtgaccac       180
     atgaagaccg tccttccgcc tgatggcccc cggcttgcct gtgtgaagaa aacctcctat       240
     ccggattgca tcaaggccat ttctgcaagt gaagccgatg ctatgacctt ggatgggggt       300
     tgggtgtacg atgccggcct gactccgaac aacctgaagc ccgtggcggc ggagttttat       360
     ggatcagtgg aacatccaca gacctactac tacgctgtgg ctgtggtaaa gaagggaaca       420
     gacttccagc tgaaccagct cgaaggcaag aagtcctgcc acacaggcct gggaaggtct       480
     gcaggctggg tcatccccat tggcttgctc ttctgtaagc tgtcggagcc ccgcagtcct       540
     cttgagaaag ctgtgtccag tttcttctcg ggcagttgtg tcccctgtgc agatccagtg       600
     gccttcccca aactgtgtca actgtgccca ggctgtggct gctcctccac tcaaccgttc       660
     tttggctacg taggcgcatt caagtgtctg aaagatggcg gtggggatgt ggcctttgtc       720
     aagcacacaa ccatatttga ggtcttgccg gagaaggctg acagggacca atatgaactg       780
     ctctgccttg acaatacccg caagccagtg gatcagtatg aggattgcta cctggctcgg       840
     atcccttctc atgctgttgt ggctcgaaaa aacaatggca aggaagactt gatctgggag       900
     attctcaaag tggcacagga acactttggc aaaggcaaat caaaagactt ccaactgttc       960
     agctctcctc ttgggaaaga cctgctgttt aaagattctg cctttgggct gttaagggtc      1020
     cccccaagga tggactacag gctgtacctt ggccataact atgtcactgc cattcggaat      1080
     cagcaggaag gcgtgtgccc ggagggctcg atcgacaact cgccagtgaa gtggtgtgca      1140
     ctgagtcacc tggagagaac caagtgtgac gagtggagca tcatcagtga gggaaagata      1200
     gagtgtgagt cagcagagac cactgaggac tgcattgaaa agattgtgaa cggagaagcg      1260
     gacgccatga ctttggatgg aggacatgcc tacattgcag gccagtgtgg tctagtgcct      1320
     gtcatggcag agtactacga gagctctaat tgtgccatcc catcacaaca aggtatcttt      1380
     cctaaagggt attatgccgt ggctgtggtg aaggcatcgg acactagcat cacctggaac      1440
     aacctgaaag gcaagaagtc ctgccacact ggggtagaca gaaccgctgg ttggaacatc      1500
     cctatgggca tgctgtacaa caggatcaac cactgcaaat tcgatgaatt tttcagtcaa      1560
     ggctgcgctc ccgggtatga gaagaattcc accctctgtg acctgtgtat tggcccactc      1620
     aaatgtgctc cgaacaacaa agaggaatat aatggttaca caggggcttt caggtgtctc      1680
     gttgagaaag gagatgtagc ctttgtgaaa caccagactg tcctggataa caccgaagga      1740
     aagaaccctg ccgaatgggc taagaatctg aagcaggaag acttcgagtt gctctgccct      1800
     gatggcacca ggaagcctgt gaaagatttt gccagctgcc acctggccca agctccaaac      1860
     catgttgtgg tctcacgaaa agagaaggca gcccgggtta aggctgtact gactagccag      1920
     gagactttat ttgggggaag tgactgcacc ggcaatttct gtttgttcaa gtctaccacc      1980
     aaggaccttc tgttcaggga tgacaccaaa tgtttcgtta aacttccaga gggtaccaca      2040
     cctgaaaaat acttaggagc ggagtacatg caatctgtcg gtaacatgag gaagtgctca      2100
     acctcacgac tcctggaagc ctgcactttc cacaaacatt aaaatccaag aggtgggttg      2160
     ccactgtggt ggagacagat gctccctccc gtggcccatg ggcttctctt ggtcttcatg      2220
     ccctgagggg ttgggactaa ctggtgtagt cttcgctgct gtgccttacc acatacacag      2280
     agcacaaaat aaaaacgact gctgacttta aaaaaaaaaa aaaa                       2324
//