spacer

EBI Dbfetch

ID   BC022734; SV 1; linear; mRNA; STD; MUS; 1439 BP.
XX
AC   BC022734;
XX
DT   06-FEB-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus N-acetylneuraminate pyruvate lyase, mRNA (cDNA clone MGC:31604
DE   IMAGE:4506776), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1439
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1439
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (01-FEB-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 821deda74bdd45f3abcf93c0a0613ac7.
DR   Ensembl-Gn; ENSMUSG00000042684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041874; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: The Cepko Laboratory
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Sequencing Group at the Stanford Human Genome
CC   Center, Stanford University School of Medicine, Stanford, CA  94305
CC   Web site:       http://www-shgc.stanford.edu
CC   Contact:  (Dickson, Mark) mcd@paxil.stanford.edu
CC   Dickson, M., Schmutz, J., Grimwood, J., Rodriquez, A., and Myers,
CC   R. M.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 44 Row: h Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 21311854.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1439
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NIH_MGC_94"
FT                   /clone="MGC:31604 IMAGE:4506776"
FT                   /tissue_type="Eye, retina, mouse strain C57Bl\6"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1439
FT                   /gene="Npl"
FT   CDS             80..1042
FT                   /codon_start=1
FT                   /gene="Npl"
FT                   /product="N-acetylneuraminate pyruvate lyase"
FT                   /db_xref="GOA:Q9DCJ9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="MGI:MGI:1921341"
FT                   /protein_id="AAH22734.1"
FT                   /translation="MAFPKKKLRGLVAATITPMTENGEINFPVIGQYVDYLVKEQGVKN
FT                   IFVNGTTGEGLSLSVSERRQVAEEWVNQGRNKLDQVVIHVGALNVKESQELAQHAAEIG
FT                   ADGIAVIAPFFFKSQNKDALISFLREVAAAAPTLPFYYYHMPSMTGVKIRAEELLDGIQ
FT                   DKIPTFQGLKFTDTDLLDFGQCVDQNHQRQFALLFGVDEQLLSALVMGATGAVGSTYNY
FT                   LGKKTNQMLEAFEQKDLASALSYQFRIQRFINYVIKLGFGVSQTKAIMTLVSGIPMGPP
FT                   RLPLQKATQEFTAKAEAKLKSLDFLSSPSVKEGKPLASA"
FT   misc_difference 1401..1439
FT                   /gene="Npl"
FT                   /note="polyA tail: 39 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1439 BP; 428 A; 306 C; 332 G; 373 T; 0 other;
     cgcgtctcca gtgcacagca gcctaggtga gcgcggcgcc accgagcaga ggagtgaagt        60
     cagaccttcc agcaacccga tggccttccc taagaagaaa ctccggggtc ttgttgctgc       120
     caccatcact ccaatgacag agaatggaga aatcaacttt cctgtcattg gtcagtatgt       180
     ggattacctg gtgaaggaac agggggtgaa gaatattttt gtgaatggca ccacaggaga       240
     aggcctgtcc ctgagcgtct ctgaacgtcg ccaggtcgcg gaggaatggg ttaaccaagg       300
     gaggaacaag ttggaccagg tggtgattca cgtgggagca ctaaacgtga aggagtcaca       360
     agaactggcc caacatgcag cagaaattgg agctgatggc attgctgtca ttgcgccttt       420
     ctttttcaag tcacagaaca aagatgccct gataagcttc ctgagagagg tggcagccgc       480
     agctcctact ttgccatttt attactacca catgccttcc atgaccgggg taaagattcg       540
     cgctgaggag ctgctggacg ggattcagga caagatcccc accttccaag gactgaagtt       600
     caccgacacg gacctcttgg atttcggcca atgtgtcgat cagaatcacc agcgacagtt       660
     tgctttgctc tttggggtgg acgaacaact gctgagtgct ctggtcatgg gagccactgg       720
     agcagtaggc agtacctata actacctggg aaaaaagaca aaccagatgt tggaagcttt       780
     tgaacagaag gacttggctt cagcgctcag ttaccagttt cgtatccaga gatttatcaa       840
     ctatgtgatc aagctaggtt ttggagtgtc gcaaaccaaa gccatcatga cgctggtctc       900
     tgggattcca atgggcccac cccggcttcc tctgcagaaa gccacccagg agtttactgc       960
     taaggctgag gccaagctaa agagcctgga tttcctttct tcccctagtg taaaggaggg      1020
     gaagccttta gctagtgcct gataagtctg ggtgtgtaag cttagactta tctatcttca      1080
     atagtacatt cttttctcag ggactttttt aggtgaattt gaacccatct ttattttagg      1140
     aagtagaatc ccacaccaat caaatattga ttatgaacct aaactttttt gttataaagg      1200
     agtcacaagc tctaagtcat tcattttgta aaattattat agagaaatct ctacttatac      1260
     agatgcaatg gaaccaagtg aaaattgtaa tagtaattac aattattaat taattacatt      1320
     aattaatata attcatatca ctatattaat tgctacattg gttatattat tgctgaataa      1380
     atttcacctg ccttttggga aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aaaaaaaaa       1439
//


spacer
spacer