spacer

EBI Dbfetch

ID   BC021828; SV 1; linear; mRNA; STD; MUS; 3110 BP.
XX
AC   BC021828;
XX
DT   28-JAN-2002 (Rel. 70, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 15)
XX
DE   Mus musculus solute carrier family 6 (neurotransmitter transporter,
DE   glycine), member 9, mRNA (cDNA clone MGC:18626 IMAGE:4194951), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3110
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-3110
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5b8902dcc46eee9b3aa5effa2aa94994.
DR   Ensembl-Gn; ENSMUSG00000028542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063857; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: k Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6680028.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3110
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:18626 IMAGE:4194951"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..3110
FT                   /gene="Slc6a9"
FT   CDS             131..2032
FT                   /codon_start=1
FT                   /gene="Slc6a9"
FT                   /product="solute carrier family 6 (neurotransmitter
FT                   transporter, glycine), member 9"
FT                   /db_xref="GOA:P28571"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR003028"
FT                   /db_xref="MGI:MGI:95760"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28571"
FT                   /protein_id="AAH21828.1"
FT                   /translation="MVGKGAKGMLNGAVPSEATKKDQNLTRGNWGNQIEFVLTSVGYAV
FT                   GLGNVWRFPYLCYRNGGGAFMFPYFIMLIFCGIPLFFMELSFGQFASQGCLGVWRISPM
FT                   FKGVGYGMMVVSTYIGIYYNVVICIAFYYFFSSMTHVLPWAYCNNPWNTPDCAGVLDAS
FT                   NLTNGSRPAALSGNLSHLFNYTLQRTSPSEEYWRLYVLKLSDDIGNFGEVRLPLLGCLG
FT                   VSWVVVFLCLIRGVKSSGKVVYFTATFPYVVLTILFVRGVTLEGAFTGIMYYLTPQWDK
FT                   ILEAKVWGDAASQIFYSLGCAWGGLITMASYNKFHNNCYRDSVIISITNCATSVYAGFV
FT                   IFSILGFMANHLGVDVSRVADHGPGLAFVAYPEALTLLPISPLWSLLFFFMLILLGLGT
FT                   QFCLLETLVTAIVDEVGNEWILQKKTYVTLGVAVAGFLLGIPLTSQAGIYWLLLMDNYA
FT                   ASFSLVVISCIMCVSIMYIYGHRNYFQDIQMMLGFPPPLFFQICWRFVSPAIIFFILIF
FT                   TVIQYRPITYNHYQYPGWAVAIGFLMALSSVICIPLYALFQLCRTDGDTLLQRLKNATK
FT                   PSRDWGPALLEHRTGRYAPTTTPSPEDGFEVQPLHPDKAQIPIVGSNGSSRFQDSRI"
FT   misc_difference 2548
FT                   /gene="Slc6a9"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 3097..3110
FT                   /gene="Slc6a9"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 3110 BP; 597 A; 948 C; 803 G; 762 T; 0 other;
     cgcggtgcgg acccagcacg cctgggccgg gggcagcagt atgctcttga ggcctgttgt        60
     ctgaaaggca ctgaacgcaa gagtctgcaa gtgtggtcca gatctccaga tcccccaacc       120
     cactgccacc atggtaggaa aaggtgccaa agggatgttg aatggtgctg tgcccagcga       180
     ggccaccaag aaggaccaga acctcacacg gggcaactgg ggcaaccaga tcgagtttgt       240
     actgacgagc gtgggctatg ccgtgggcct gggcaatgtc tggcgtttcc catacctctg       300
     ctatcgcaac gggggaggag ccttcatgtt cccctacttc atcatgctga tcttctgcgg       360
     gattcctctc ttcttcatgg agctttcctt cggccagttt gcaagccagg gctgcctggg       420
     ggtctggcgg atcagcccca tgttcaaagg cgtgggctat ggtatgatgg tggtgtccac       480
     atacattggc atctactaca acgtggtcat ctgcatcgcc ttctactact tcttctcgtc       540
     catgacgcac gtgctgccct gggcgtactg caacaacccc tggaacacac ctgactgtgc       600
     cggtgtgctg gacgcttcca acctcaccaa tggctcccgg cccgctgccc tgtctggcaa       660
     cctgtctcac ctgttcaact acaccttgca aaggaccagc cccagcgagg agtactggag       720
     gctgtatgtg ctgaagctgt cagacgacat tggaaacttt ggggaagtgc ggcttcccct       780
     cctaggctgc ctcggcgtct cctgggtggt tgtcttcctc tgtctcatcc gaggagtcaa       840
     gtcttcaggg aaagtggtgt acttcacggc cacattcccc tatgtggtgc tgaccattct       900
     gtttgttcgt ggagtgaccc tggaaggagc cttcacgggt atcatgtact acctgacccc       960
     acaatgggac aagatcctgg aggccaaggt ctggggggat gcagcctctc agatcttcta      1020
     ttccctgggc tgtgcatggg gtggcctcat caccatggcg tcctacaaca aatttcacaa      1080
     caactgctac cgggacagcg tcattatcag tatcaccaac tgtgctacca gcgtctacgc      1140
     cggcttcgtc atcttctcca tcctgggctt catggccaat cacctgggtg tggatgtgtc      1200
     tcgggtggca gaccatgggc ctgggctagc ttttgtcgct taccctgagg ctctcacgct      1260
     gcttcccatc tctccactct ggtccttatt gtttttcttc atgctcatct tgctggggct      1320
     gggtactcag ttctgcctcc tagagaccct ggtcactgcc attgtggatg aggtagggaa      1380
     tgagtggatt ctgcagaaga agacctacgt gaccttgggc gtcgctgtgg ctggcttctt      1440
     gctgggcatc ccccttacca gccaggcagg catctactgg ctgctgctga tggacaacta      1500
     tgcagccagc ttctccttgg ttgtcatctc ctgtatcatg tgtgtatcca tcatgtacat      1560
     ctatgggcac cgtaactact tccaggacat ccagatgatg ctaggatttc ccccgcctct      1620
     cttcttccag atctgttggc gctttgtttc tccggctatc atctttttca ttctcatctt      1680
     cacggtgatc cagtaccggc caatcaccta caaccactac cagtacccag gctgggctgt      1740
     ggccatcggc ttcctcatgg ctttgtcgtc tgtcatctgc atcccactgt acgcgctgtt      1800
     ccagctctgc cgcacagatg gggacacact tcttcagcgt ttgaaaaatg ccacaaagcc      1860
     aagcagagac tggggccccg ctctcctgga gcaccggact gggcgctacg ctcccactac      1920
     aaccccctct cccgaagacg ggtttgaggt ccagccactg cacccggaca aggcccagat      1980
     tcccatcgtg ggcagtaacg gctccagccg cttccaggac tcccggatat gagcgcaatt      2040
     gttgcaaggg gagaaacccc acccaaccct tgctcccacc acggagactg ggaggcggac      2100
     aggtggaggc ctgccccatc acaccctgtc tgggatggct gctgtcacct tgaccaccac      2160
     tgctcatgtc cccagtgttt acacatcctt tggatgccaa gacagcagct gggggtggga      2220
     aagcgatggg ggaattgggg ggagcgggca tggggaagca gtgtccaaag cactttggag      2280
     gaggcctgcc aggcttccta tggcctctga taccctcatg ctctgccctg agctgtttca      2340
     ctatgggata agaggttctg tgtccacatc ccaccggttc ccctcagcct cgtgaccagt      2400
     gttcctgacc ccagaacaga ccctagcctc tgcccaggaa aatctgtatc ttcctcctcc      2460
     agacaaggtg agggccccgg ggctgtacag tgttacttgt tggactgcac cactcagccc      2520
     tgtttatttg tgtaattatt ttttttttaa attgtattac ctgtggttgc catcccctgc      2580
     cccagccttg ggtccagtgt gtcttccagg cctgcctgca cctcacttgg ctgctccagg      2640
     gtctctatcc tttgttccaa ccctggttgt caggcccagc cagcaaaggc ccacgaccca      2700
     gcagcctgcc caaagcactt gtttatggag ggaaagaagg ggacttctct gtaggaagct      2760
     tgagcccaga gccctgggga aggggaccct gttccacatt cccttgccca ccctccacca      2820
     ggtcggaggc ccagtcttcc cagacgtgct aaccccattc aatgtgccaa atggcctcag      2880
     tccatgtgcc cgtcccccct ctgcagtcag agcaccttct cccaagaccc gcagtccgtt      2940
     tgtccgtcct ctgtgccctc tgcagtgaca gccctggcca agccacttct aatcctctgt      3000
     agcaataacg gtgtgccgcc cgccgctgcc cagtgtgtgc agaactaggg ttttaaagtc      3060
     cgtaggtttt aatgaaattt ctattcctgt ctctgaaaaa aaaaaaaaaa                 3110
//


spacer
spacer