Dbfetch

ID   BC021798; SV 1; linear; mRNA; STD; MUS; 1782 BP.
XX
AC   BC021798;
XX
DT   28-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus peroxisome proliferator activated receptor gamma, mRNA (cDNA
DE   clone MGC:18439 IMAGE:4191539), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1782
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1782
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (18-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 5067ab4e1c6b7c838e0793d25a3f8913.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031148; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0031117; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0031048; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031128; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0030580; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0031587; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030235; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0030814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0030967; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0030921; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031047; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0030955; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0031614; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0029951; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0030319; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0079461; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0079532; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0079455; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0079475; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0077821; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0079951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0079685; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0079060; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0079212; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0079097; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0079245; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0079102; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0080199; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0079112; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0078206; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 24 Row: i Column: 13
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6755137.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1782
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:18439 IMAGE:4191539"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1782
FT                   /gene="Pparg"
FT                   /note="synonyms: PPAR-gamma2, Nr1c3, PPAR-gamma"
FT   CDS             46..1563
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator activated receptor gamma"
FT                   /db_xref="GOA:Q6GU14"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GU14"
FT                   /protein_id="AAH21798.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
FT   misc_difference 1757
FT                   /gene="Pparg"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1759
FT                   /gene="Pparg"
FT                   /note="'C' in cDNA is 'A' in the mouse genome."
FT   misc_difference 1768..1782
FT                   /gene="Pparg"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1782 BP; 533 A; 416 C; 386 G; 447 T; 0 other;
     caaaacacca gtgtgaatta cagcaaatct ctgttttatg ctgttatggg tgaaactctg        60
     ggagattctc ctgttgaccc agagcatggt gccttcgctg atgcactgcc tatgagcact       120
     tcacaagaaa ttaccatggt tgacacagag atgccattct ggcccaccaa cttcggaatc       180
     agctctgtgg acctctccgt gatggaagac cactcgcatt cctttgacat caagcccttt       240
     accacagttg atttctccag catttctgct ccacactatg aagacattcc attcacaaga       300
     gctgacccaa tggttgctga ttacaaatat gacctgaagc tccaagaata ccaaagtgcg       360
     atcaaagtag aacctgcatc tccaccttat tattctgaaa agacccagct ctacaacagg       420
     cctcatgaag aaccttctaa ctccctcatg gccattgagt gccgagtctg tggggataaa       480
     gcatcaggct tccactatgg agttcatgct tgtgaaggat gcaagggttt tttccgaaga       540
     accatccgat tgaagcttat ttatgatagg tgtgatctta actgccggat ccacaaaaaa       600
     agtagaaata aatgtcagta ctgtcggttt cagaagtgcc ttgctgtggg gatgtctcac       660
     aatgccatca ggtttgggcg gatgccacag gccgagaagg agaagctgtt ggcggagatc       720
     tccagtgata tcgaccagct gaacccagag tctgctgatc tgcgagccct ggcaaagcat       780
     ttgtatgact catacataaa gtccttcccg ctgaccaaag ccaaggcgag ggcgatcttg       840
     acaggaaaga caacggacaa atcaccattt gtcatctacg acatgaattc cttaatgatg       900
     ggagaagata aaatcaagtt caaacatatc acccccctgc aggagcagag caaagaggtg       960
     gccatccgaa tttttcaagg gtgccagttt cgatccgtag aagccgtgca agagatcaca      1020
     gagtatgcca aaaatatccc tggtttcatt aaccttgatt tgaatgacca agtgactctg      1080
     ctcaagtatg gtgtccatga gatcatctac acgatgctgg cctccctgat gaataaagat      1140
     ggagtcctca tctcagaggg ccaaggattc atgaccaggg agttcctcaa aagcctgcgg      1200
     aagccctttg gtgactttat ggagcctaag tttgagtttg ctgtgaagtt caatgcactg      1260
     gaattagatg acagtgactt ggctatattt atagctgtca ttattctcag tggagaccgc      1320
     ccaggcttgc tgaacgtgaa gcccatcgag gacatccaag acaacctgct gcaggccctg      1380
     gaactgcagc tcaagctgaa tcacccagag tcctctcagc tgttcgccaa ggtgctccag      1440
     aagatgacag acctcaggca gatcgtcaca gagcacgtgc agctactgca tgtgatcaag      1500
     aagacagaga cagacatgag ccttcacccc ctgctccagg agatctacaa ggacttgtat      1560
     tagcaggaaa gtcccacccg ctgacaacgt gttccttcta ttgattgcac tattattttg      1620
     agggaaaaaa atctgacacc taagaaattt actgtgaaaa agcatttaaa aacaaaaagt      1680
     tttagaacat gatctatttt atgcatattg tttataaaga tacatttaca atttactttt      1740
     aatattaaaa attaccccct tataaaaaaa aaaaaaaaaa aa                         1782
//