Dbfetch

ID   BC021647; SV 1; linear; mRNA; STD; MUS; 2234 BP.
XX
AC   BC021647;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 12)
XX
DE   Mus musculus solute carrier family 22 (organic anion transporter), member
DE   6, mRNA (cDNA clone MGC:13982 IMAGE:4163278), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2234
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2234
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (14-JAN-2002) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; efc4ba9e8210a6c6ee8cbabe057c39a7.
DR   Ensembl-Gn; ENSMUSG00000024650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000010250; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Institute for Systems Biology
CC   http://www.systemsbiology.org
CC   contact: amadan@systemsbiology.org
CC   Anup Madan, Jessica Fahey, Erin Helton, Mark Ketteman, Anuradha
CC   Madan, Stephanie Rodrigues, Amy Sanchez and Michelle Whiting
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 18 Row: j Column: 19
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982136.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2234
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:13982 IMAGE:4163278"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2234
FT                   /gene="Slc22a6"
FT                   /note="synonyms: NKT, Oat1"
FT   misc_difference 1..13
FT                   /gene="Slc22a6"
FT                   /note="13 bases at the 5' end do not align to the mouse
FT                   genome."
FT   misc_difference 240
FT                   /gene="Slc22a6"
FT                   /note="'T' in cDNA is 'G' in the mouse genome."
FT   CDS             269..1906
FT                   /codon_start=1
FT                   /gene="Slc22a6"
FT                   /product="solute carrier family 22 (organic anion
FT                   transporter), member 6"
FT                   /db_xref="GOA:Q8VC69"
FT                   /db_xref="InterPro:IPR004749"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="MGI:MGI:892001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC69"
FT                   /protein_id="AAH21647.1"
FT                   /translation="MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIP
FT                   AHHCRPPANANLSKDGGLEAWLPLDKQGRPESCLRFPFPHNGTEANGTGVTEPCLDGWV
FT                   YDNSTFPSTIVTEWNLVCSHRAFRQLAQSLFMVGVLLGAMMFGYLADRLGRRKVLILNY
FT                   LQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPIHTRAYVGTLIGY
FT                   VYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYSWFFIESARWYSSSGRLDLTLRA
FT                   LQRVARINGKQEEGAKLSIEVLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLW
FT                   FATSFAYYGLVMDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLA
FT                   GICILVNGIIPRGHTIIRTSLAVLGKGCLASSFNCIFLYTGELYPTMIRQTGLGMGSTM
FT                   ARVGSIVSPLISMTAEFYPSIPLFIFGAVPVAASAVTALLPETLGQPLPDTVQDLKSRS
FT                   RGKQKQQQLEQQKQMIPLQVSTQEKNGL"
FT   misc_difference 2219..2234
FT                   /gene="Slc22a6"
FT                   /note="polyA tail: 16 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2234 BP; 491 A; 676 C; 593 G; 474 T; 0 other;
     ccacgcgtcc gagctgagct gtccagaccc ccgaagtgaa gaaaagaggc gagggcaagg        60
     gagggccaga accaggggag agagaaagga ggggcagccc accagcccgc tgtctcgcca       120
     cagaaccggc tcagctccaa ctccaggagt cactcagctg cagaggcagt ggcagcccta       180
     ctcctcaggc aaagggcagc agacagacag acagaggtcc taggactgga ggtcctcagt       240
     cattgaccac tcagcctggc ccagccccat ggccttcaat gacctcctga aacaggtggg       300
     gggtgtcgga cgcttccagc tgatccaggt caccatggtg gttgctcccc tactgctgat       360
     ggcttcccac aacaccctgc agaacttcac tgctgctatc cccgctcacc actgccgccc       420
     acctgctaat gccaacctca gcaaagatgg aggtctggag gcctggctgc ccctggacaa       480
     gcaaggacga cccgaatctt gcctccgctt tcctttcccg cacaatggca cagaggccaa       540
     tggcaccgga gtcacagagc cctgccttga tggctgggtc tatgacaaca gcaccttccc       600
     ttcaaccatc gtgactgagt ggaaccttgt gtgctctcat cgggccttcc gccagctggc       660
     ccagtccctg ttcatggtgg gagtgttact gggagccatg atgtttggct acctggcgga       720
     caggctgggc cgtcggaagg tgctgatctt gaactacctg caaacagctg tgtcgggaac       780
     ctgtgcagcc tatgcaccca actatactgt ctactgcatt ttccggctcc tctcgggcat       840
     gtctttggct agcattgcaa tcaactgcat gacactaaac atggagtgga tgcctattca       900
     cacccgtgcc tatgtgggca ccttgattgg ctatgtctac agcttgggcc agttcctcct       960
     ggctggtatc gcctatgctg tgccccactg gcgccacctg cagcttgcgg tctctgtgcc      1020
     ttttttcgtt gccttcatct actcttggtt cttcattgag tcagcccgct ggtactcctc      1080
     ctctggaagg ctggacctca ccctccgagc cctgcagaga gtggcccgca tcaacgggaa      1140
     acaagaagag ggggctaagc tgagtataga ggtgctccag accagcctgc agaaggaact      1200
     gactctaaac aaaggccagg cctccgccat ggagctgctg cgctgcccca cgcttcggcg      1260
     cctcttcctc tgcctctcta tgctgtggtt tgccactagc tttgcctact acgggctggt      1320
     catggacctg cagggctttg gggtcagcat gtaccttatc caggtgattt tcggcgctgt      1380
     ggacctgcct gccaagtttg tgtgcttcct agtcatcaat tccatgggcc gccggcctgc      1440
     acagttggcc tccctgctgc tggcaggcat ctgtatccta gtgaatggca taataccgag      1500
     gggccataca atcattcgca catccctggc tgtactaggg aaaggctgtc tggcttcctc      1560
     tttcaactgc atcttcctgt acaccggaga gctgtacccc acaatgattc ggcagacggg      1620
     cctgggcatg ggcagcacca tggcccgggt gggcagcata gtgagcccac tgataagcat      1680
     gactgccgag ttctacccct ccatacctct cttcatcttc ggcgctgtcc ccgtggccgc      1740
     cagcgctgtc actgccctgc tgccagagac cttgggccag ccgctgcctg atacagtgca      1800
     ggacctgaag agcaggagca gaggaaagca gaagcaacag cagctggaac agcagaagca      1860
     gatgatacca ctccaggtct caacacaaga gaagaacgga ctctgaaaat ggagagggcg      1920
     tcacacagca ctaaagggag tggggttctg caggtcccac catctatgag gagggggagt      1980
     gagtggaggg actgggccat ctaaatgcgg agcctgccat tcagagaaat gcctccccaa      2040
     aggtcacttc aatagaccta ctaggaacaa aagctctaac tgtgtgcagc ttcttaagca      2100
     gaatgagctc ttcctcagcc atcttccagc tcagtggtca ctcctccagc tcctgtccct      2160
     tccacctcca ggacattgca aagaatccca gacaattaaa taaatttctt ctaccttgaa      2220
     aaaaaaaaaa aaag                                                        2234
//