spacer

EBI Dbfetch

ID   BC020187; SV 1; linear; mRNA; STD; MUS; 1875 BP.
XX
AC   BC020187;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 16)
XX
DE   Mus musculus adenylosuccinate lyase, mRNA (cDNA clone MGC:28899
DE   IMAGE:4913637), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1875
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1875
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; d654b41564ac7e996192ec054d344806.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Genome Sequence Centre,
CC   BC Cancer Agency, Vancouver, BC, Canada
CC   info@bcgsc.bc.ca
CC   Martin Hirst, Thomas Zeng, Ryan Morin, Michelle Moksa, Johnson
CC   Pang, Diana Mah, Jing Wang, Kieth Fichter, Eric Chuah, Allen
CC   Delaney, Rob Kirkpatrick, Agnes Baross, Sarah Barber, Mabel
CC   Brown-John, Steve S. Chand, William Chow, Ryan Babakaiff, Dave
CC   Wong, Corey Matsuo, Jaclyn Beland, Susan Gibson, Luis delRio, Ruth
CC   Featherstone, Malachi Griffith, Obi Griffith, Ran Guin, Nancy Liao,
CC   Kim MacDonald,  Mike R. Mayo, Josh Moran, Diana Palmquist, JR
CC   Santos, Duane Smailus, Jeff Stott, Miranda Tsai, George Yang,
CC   Jacquie Schein, Asim Siddiqui,Steven Jones, Rob Holt, Marco Marra.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 38 Row: n Column: 6
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31982252.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1875
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_SG2"
FT                   /clone="MGC:28899 IMAGE:4913637"
FT                   /tissue_type="Salivary gland, 10 week old female mouse"
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1875
FT                   /gene="Adsl"
FT   CDS             35..1489
FT                   /codon_start=1
FT                   /gene="Adsl"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="AAH20187.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
FT   misc_difference 319
FT                   /gene="Adsl"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1866..1875
FT                   /gene="Adsl"
FT                   /note="polyA tail: 10 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1875 BP; 481 A; 481 C; 514 G; 399 T; 0 other;
     ctggtgtccg ccgcgtcctg gtcgcgtgtt gaaaatggct gcatccggcg accctggcag        60
     tgctgaaagt taccgttctc cgctggcggc ccgctacgcc agccgcgaga tgtgtttctt       120
     gttcagcgac aggtacaagt tccagacgtg gcggcagctg tggctgtggc tggcggaggc       180
     cgaacagacg ctgggtttgc ctatcacaga tgaacaaatc caggagatga agtcgaacct       240
     gaacaacatt gacttccaga tggcagctga ggaagagaag cgcctgcggc acgacgtgat       300
     ggctcacgtg cacacgttcg gccactgctg tccgaaagct gcgggcatta ttcatctggg       360
     cgccacctcc tgctatgtcg gagacaatac ggacctgatt attctgagaa atgcatttga       420
     cctacttttg ccaaagcttg ctagagtgat ctcgaggctt gccgactttg ctaaggatcg       480
     tgctgatctg cccacgttag gtttcacaca ctttcagcct gctcagctga ccacggttgg       540
     gaaacgatgc tgcctttgga ttcaagatct ctgcatggat ctccagaact tgaagcgtgt       600
     ccgggatgag ctgcgcttcc gaggagtaaa gggcaccact ggcacgcagg ccagcttcct       660
     gcagctcttc gagggggatc accagaaggt ggagcagctg gacaagatgg tgacagaaaa       720
     ggcagggttt aaaagagcct tcatcatcac aggacagacg tacacacgga aagtggacat       780
     cgaagtgctg tctgtgctgg ccagcttagg agcatcggtg cacaagattt gcactgacat       840
     acgcctgctg gcaaacctga aggagatgga ggagcccttt gagaaacagc agattggctc       900
     cagtgcgatg ccgtacaagc ggaaccccat gcgctccgaa cgttgctgca gcctggcccg       960
     tcacctgatg gcccttacca tggacccact acagacagcg tctgtgcagt ggtttgaacg      1020
     tactctggat gacagtgcca accgacggat ctgtttggct gaagcgtttc tcactgcaga      1080
     tactatatta aacaccctac agaacatttc tgaaggattg gtggtgtacc ccaaagtaat      1140
     tgaacggcgc attcggcaag agctgccttt catggccaca gagaacatca tcatggcaat      1200
     ggtgaaagcc gggggcagcc gacaggactg ccatgagaaa attagagtgc tttcccagca      1260
     ggcagctgct gtggtcaagc aggaaggagg tgacaatgac cttatagagc gcatccgggc      1320
     agatgcctac ttcagcccca tccactcaca gctggagcac ttgctggacc cctcttcttt      1380
     cactggccga gcaccccagc aggtccacag attcctggaa gaggaagtgc gccccctgct      1440
     aaagccctat gggaatgaga tggcggtgaa agcagagctg tgtctgtaga gtaggagagc      1500
     tgaggagaac ccggttacag tgattagagc ttgctgatta cagtgttaga gttactactg      1560
     tgttctgcgg cactccttta cacactcagg aggcagaggc aggcagatct ctgagttcaa      1620
     ggccagcctg gtctacaaaa caagttccag gacagccaga gctacacaga gaaaccctgt      1680
     ctcaacaaac aaacaaacag aggctgggga catggcactg actgctcttc caaaggtcct      1740
     gagttcaaat cccagcaacc acatggtggc tcacaaccat ctgtaatgag atctgatgcc      1800
     ctcttctggt gcatgaagac agctacagtg tattcatata cataaaataa atgaatcttt      1860
     aaaaaaaaaa aaaaa                                                       1875
//


spacer
spacer