spacer

EBI Dbfetch

ID   BC020144; SV 1; linear; mRNA; STD; MUS; 988 BP.
XX
AC   BC020144;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 10)
XX
DE   Mus musculus desmoglein 2, mRNA (cDNA clone IMAGE:3993281), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-988
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-988
RA   Strausberg R.;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Cancer
RL   Genomics Office, National Cancer Institute, 31 Center Drive, Room 11A03,
RL   Bethesda, MD 20892-2590, USA
XX
DR   MD5; 1c0675416db425ee29eb9a4984dcbdaf.
DR   Ensembl-Gn; ENSMUSG00000044393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121837; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 36 Row: j Column: 15
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 22779878
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..988
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="IMAGE:3993281"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..988
FT                   /gene="Dsg2"
FT   CDS             64..942
FT                   /codon_start=1
FT                   /gene="Dsg2"
FT                   /product="Dsg2 protein"
FT                   /db_xref="GOA:Q8VCE3"
FT                   /db_xref="InterPro:IPR002126"
FT                   /db_xref="InterPro:IPR009122"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR020894"
FT                   /db_xref="MGI:MGI:1196466"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VCE3"
FT                   /protein_id="AAH20144.1"
FT                   /translation="MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPK
FT                   HTHLVRQKRAWITAPVALREGEDLSRKNPIAKIHSDLAEEKGIKITYKYTGKGITEPPF
FT                   GIFVFDRNTGELNITSILDREETPYFLLTGYALDSRGNNLEKPLELRIKVLDINDNEPV
FT                   FTQEVFVGSIEELSAAHTLVMKITATDADDPETLNAKVSYRIVSQEPANSHMFYLNKDT
FT                   GEIYTTSFTLDREEHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENKM
FT                   VTQFYSRLTIS"
FT   misc_feature    262..870
FT                   /gene="Dsg2"
FT                   /note="CA; Region: Cadherin repeat domain"
XX
SQ   Sequence 988 BP; 301 A; 222 C; 256 G; 209 T; 0 other;
     cggacgcgtg ggcggacgcg tgggcggcga ggcccggagg cgagggcgcg gcggatcgag        60
     gcgatggcgc ggagcccggg tgaccggtgc gccctgctgc tgctggtgca gctgctggcg       120
     gtggtctgct tggactttgg aaatggactt cacttagagg tcttcagccc aagaaatgaa       180
     ggcaaaccgt tccctaagca cactcacttg gttcgtcaaa agagggcctg gatcactgcc       240
     cctgtggctc tgcgggaggg cgaagacctg tccagaaaga acccgattgc caagatacac       300
     tctgaccttg cagaagaaaa agggataaaa atcacgtaca agtacactgg gaagggaatt       360
     acagaaccgc ctttcggcat attcgtcttt gatagaaaca caggagaact gaacatcact       420
     agcattcttg accgggaaga aacaccatat tttctgctga caggctatgc attggactcc       480
     agaggaaaca acctggaaaa gcccttggaa ctacgcatca aagttctgga catcaatgac       540
     aacgagccag tgttcacaca ggaggtcttt gttgggtcca ttgaggaatt gagtgcagca       600
     catacacttg tgatgaaaat caccgccaca gatgcagatg acccggagac tctgaatgct       660
     aaagtctcct acagaattgt ctctcaggag cctgcaaata gtcatatgtt ctacctaaat       720
     aaagacacgg gggagatcta tacgaccagt tttactttgg acagagagga acacagcagc       780
     tattccttga cggtggaagc aagagatggt aacgggcaga taacagacaa gccagtccag       840
     caagctcaag ttcagatccg tatattggat gtcaatgaca atatacctgt ggtagaaaac       900
     aaaatggtaa ctcagtttta tagtagactt actatttcct gaatcacaac taaaattaca       960
     ttattgcatt aaaaaaaaaa aaaaaaaa                                          988
//


spacer
spacer