spacer

EBI Dbfetch

ID   BC019998; SV 1; linear; mRNA; STD; MUS; 2731 BP.
XX
AC   BC019998;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus nicastrin, mRNA (cDNA clone MGC:28725 IMAGE:4458780), complete
DE   cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2731
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2731
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e8242443785844c22bce33d336bd40c3.
DR   Ensembl-Gn; ENSMUSG00000003458; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003550; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 37 Row: o Column: 21
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31981204.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2731
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam1"
FT                   /clone="MGC:28725 IMAGE:4458780"
FT                   /tissue_type="Mammary tumor. Metallothionien-TGF alpha
FT                   model. 10 month old virgin mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2731
FT                   /gene="Ncstn"
FT                   /note="synonyms: Kiaa0253, Aph2, mKIAA0253, Nct"
FT   CDS             13..2139
FT                   /codon_start=1
FT                   /gene="Ncstn"
FT                   /product="nicastrin"
FT                   /db_xref="GOA:P57716"
FT                   /db_xref="InterPro:IPR008710"
FT                   /db_xref="MGI:MGI:1891700"
FT                   /db_xref="UniProtKB/Swiss-Prot:P57716"
FT                   /protein_id="AAH19998.1"
FT                   /translation="MATTRGGSGPDPGSRGLLLLSFSVVLAGLCGGNSVERKIYIPLNK
FT                   TAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLKWVLTDGPNPPYMVLLEGKLFTR
FT                   DVMEKLKGTTSRIAGLAVTLAKPNSTSSFSPSVQCPNDGFGIYSNSYGPEFAHCKKTLW
FT                   NELGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLGQNGSAPSFPLCAMQLFSHMHA
FT                   VISTATCMRRSFIQSTFSINPEIVCDPLSDYNVWSMLKPINTSVGLEPDVRVVVAATRL
FT                   DSRSFFWNVAPGAESAVASFVTQLAAAEALHKAPDVTTLSRNVMFVFFQGETFDYIGSS
FT                   RMVYDMENGKFPVRLENIDSFVELGQVALRTSLDLWMHTDPMSQKNESVKNQVEDLLAT
FT                   LEKSGAGVPEVVLRRLAQSQALPPSSLQRFLRARNISGVVLADHSGSFHNRYYQSIYDT
FT                   AENINVTYPEWQSPEEDLNFVTDTAKALANVATVLARALYELAGGTNFSSSIQADPQTV
FT                   TRLLYGFLVKANNSWFQSILKHDLRSYLDDRPLQHYIAVSSPTNTTYVVQYALANLTGK
FT                   ATNLTREQCQDPSKVPNESKDLYEYSWVQGPWNSNRTERLPQCVRSTVRLARALSPAFE
FT                   LSQWSSTEYSTWAESRWKDIQARIFLIASKELEFITLIVGFSILIFSLIVTYCINAKAD
FT                   VLFVAPREPGAVSY"
FT   misc_difference 231
FT                   /gene="Ncstn"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 765
FT                   /gene="Ncstn"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1086
FT                   /gene="Ncstn"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1284
FT                   /gene="Ncstn"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1592
FT                   /gene="Ncstn"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'K' in cDNA, 'R' in the mouse genome."
FT   misc_difference 1621
FT                   /gene="Ncstn"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2045
FT                   /gene="Ncstn"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; amino acid
FT                   difference: 'I' in cDNA, 'T' in the mouse genome."
FT   misc_difference 2050
FT                   /gene="Ncstn"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'I' in cDNA, 'V' in the mouse genome."
FT   misc_difference 2058
FT                   /gene="Ncstn"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2103
FT                   /gene="Ncstn"
FT                   /note="'T' in cDNA is 'C' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 2156
FT                   /gene="Ncstn"
FT                   /note="'G' in cDNA is 'C' in the mouse genome."
FT   misc_difference 2316
FT                   /gene="Ncstn"
FT                   /note="1 base in cDNA is not found in the mouse genome."
FT   misc_difference 2717..2731
FT                   /gene="Ncstn"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2731 BP; 646 A; 754 C; 660 G; 671 T; 0 other;
     cggagaggca agatggctac gactaggggc ggctctgggc ctgacccagg aagtcggggt        60
     cttcttcttc tgtctttttc cgtggtactg gcaggattgt gtgggggaaa ctcagtggag       120
     aggaaaatct acattccctt aaataaaaca gctccttgtg tccgcctgct caacgccact       180
     catcagattg gctgccagtc ttcaattagt ggggatacag gggttatcca cgtagtggag       240
     aaagaagaag acctgaagtg ggtgttgacc gatggcccca acccccctta catggttctg       300
     ctggagggca agctcttcac cagagatgta atggagaagc tgaagggaac aaccagtaga       360
     atcgctggtc ttgccgtgac tctagccaag cccaactcaa cttcaagctt ctctcctagt       420
     gtgcagtgcc caaatgatgg gtttggtatt tactccaact cctacgggcc agagtttgct       480
     cactgcaaga aaacactgtg gaatgaactg ggcaacggct tggcttatga agactttagt       540
     ttccccatct ttcttcttga agatgagaac gaaaccaagg tcatcaagca gtgctatcaa       600
     gatcacaacc tgggtcagaa tggctctgca ccaagcttcc cattgtgtgc tatgcagctc       660
     ttctcacaca tgcacgccgt catcagcact gccacctgca tgcggcgcag cttcatccag       720
     agcaccttca gcatcaaccc agaaatcgtc tgtgacccct tatctgacta caacgtatgg       780
     agcatgctta agcctataaa tacatctgtg ggactagaac ctgacgtcag ggttgtggtt       840
     gcggccacac ggctggatag ccggtccttt ttctggaatg tggccccagg ggctgaaagt       900
     gctgtagcct cctttgtcac tcagctggct gcagctgaag ctttgcacaa ggcacctgat       960
     gtgaccactc tatcccgaaa tgtgatgttt gtcttcttcc agggggaaac ttttgactac      1020
     attggcagct cacggatggt ctatgatatg gagaacggca agtttcccgt gcggctcgag      1080
     aacatcgact ccttcgtgga gctgggacag gtggccctaa gaacttcact agatctctgg      1140
     atgcacacag atcccatgtc tcagaaaaat gagtctgtga aaaaccaggt ggaggatctt      1200
     ctggccactc tggagaagag cggtgctggt gtccctgaag ttgtcctgag gagactggcc      1260
     cagtcccagg cccttccacc ttcatctcta caacgatttc ttcgggctcg aaacatctct      1320
     ggcgtggtcc tggctgacca ctctggctcc ttccacaatc ggtattacca gagcatttat      1380
     gacacggctg agaacattaa tgtgacctat cctgagtggc agagcccaga agaggacctc      1440
     aactttgtga cagacactgc caaggcactg gcgaatgtgg ccacagtgct ggcgcgtgca      1500
     ctgtatgagc ttgcaggagg aaccaacttc agcagctcca tccaggctga tccccagaca      1560
     gttacacgtc tgctctatgg gttcctggtt aaagctaaca actcatggtt tcagtcgatc      1620
     ctgaaacatg acctaaggtc ctatttggat gacaggcctc ttcaacacta catcgccgtc      1680
     tccagcccta ccaacacgac ttacgttgtg cagtacgcct tggcaaacct gactggcaag      1740
     gcgaccaacc tcacccgaga gcagtgccag gatccaagta aagtcccaaa tgagagcaag      1800
     gatttatatg aatactcgtg ggtacaaggc ccttggaatt ccaacaggac agagaggctc      1860
     ccacagtgtg tgcgctccac agtgcgactg gccagggcct tgtcccctgc ctttgaactg      1920
     agtcagtgga gctccacaga atactctacg tgggcggaga gccgctggaa agacatccaa      1980
     gctcggatat tcctaattgc cagcaaagag cttgagttca tcacgctgat cgtgggcttc      2040
     agcatcctta tcttctctct catcgtcacc tactgcatca atgccaaagc cgacgtcctt      2100
     tttgttgctc cccgagagcc aggagctgtg tcttactgaa gaggactcta gctctgcctg      2160
     cctgctctga actttacttc ccagaccagg tgtccggctg ggaacaaacc actaatttgt      2220
     cactggactg tctctgggcc tgcttagacg gggattgaca cacagaatgg aactgtgagt      2280
     ggagagatga ataagttgcc cccccagccc ccctttccca tttgtttctc cttctctaat      2340
     cccagggact atggtagaga cttgctgctc ctaactcccc agttacccac cctcctctgc      2400
     cctttctcgg gataccttct gtccttccat cctgccctgt actgccctct gactccactg      2460
     tcacccgaca cccctccccc atattcagcc acctgctgca ccaggaagag ggtgtgaaag      2520
     attgtgcatc tgcattcaac taccctgaac ccttagggaa gaaatggatt ccctggctga      2580
     gccagtgtct ctttcccact gtcctttctc caggtgtgca gatggcatgt tagtgtgggc      2640
     acgctgttaa gtgggtatcc cacctccagc ccacagtgct cagttgtact ttttattatt      2700
     aaactataat tatctaaaaa aaaaaaaaaa a                                     2731
//


spacer
spacer