spacer

EBI Dbfetch

ID   BC019953; SV 1; linear; mRNA; STD; MUS; 1359 BP.
XX
AC   BC019953;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus interleukin 23, alpha subunit p19, mRNA (cDNA clone MGC:28058
DE   IMAGE:3708687), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1359
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1359
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e80b1a83c6a2b915d688f41d43069957.
DR   Ensembl-Gn; ENSMUSG00000025383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000026449; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey Green M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 36 Row: b Column: 18
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 13752578.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1359
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam6"
FT                   /clone="MGC:28058 IMAGE:3708687"
FT                   /tissue_type="Mammary tumor. C3(1)-Tag model. Infiltrating
FT                   ductal carcinoma. 5 month old virgin mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1359
FT                   /gene="Il23a"
FT                   /note="synonym: p19"
FT   CDS             97..687
FT                   /codon_start=1
FT                   /gene="Il23a"
FT                   /product="interleukin 23, alpha subunit p19"
FT                   /db_xref="GOA:Q9EQ14"
FT                   /db_xref="InterPro:IPR003573"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR010831"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:1932410"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQ14"
FT                   /protein_id="AAH19953.1"
FT                   /translation="MLDCRAVIMLWLLPWVTQGLAVPRSSSPDWAQCQQLSRNLCMLAW
FT                   NAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHL
FT                   LDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLR
FT                   SKILRSLQAFLAIAARVFAHGAATLTEPLVPTA"
FT   misc_difference 1345..1359
FT                   /gene="Il23a"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1359 BP; 394 A; 321 C; 333 G; 311 T; 0 other;
     tacagagtta gactcagaac caaaggaggt ggataggggg tccacaggcc tggtgcagat        60
     cacagagcca gccagatctg agaagcaggg aacaagatgc tggattgcag agcagtaata       120
     atgctatggc tgttgccctg ggtcactcag ggcctggctg tgcctaggag tagcagtcct       180
     gactgggctc agtgccagca gctctctcgg aatctctgca tgctagcctg gaacgcacat       240
     gcaccagcgg gacatatgaa tctactaaga gaagaagagg atgaagagac taaaaataat       300
     gtgccccgta tccagtgtga agatggttgt gacccacaag gactcaagga caacagccag       360
     ttctgcttgc aaaggatccg ccaaggtctg gctttttata agcacctgct tgactctgac       420
     atcttcaaag gggagcctgc tctactccct gatagcccca tggagcaact tcacacctcc       480
     ctactaggac tcagccaact cctccagcca gaggatcacc cccgggagac ccaacagatg       540
     cccagcctga gttctagtca gcagtggcag cgcccccttc tccgttccaa gatccttcga       600
     agcctccagg cctttttggc catagctgcc cgggtctttg cccacggagc agcaactctg       660
     actgagccct tagtgccaac agcttaagga tgcccaggtt cccatggcta ccatgataag       720
     actaatctat cagcccagac atctaccagt taattaaccc attaggactt gtgctgttct       780
     tgttttgttt gttttgcgtg aagggcaagg acaccattat taaagagaaa agaaacaaac       840
     cccagagcag gcagctggct agagaaagga gctggagaag aagaataaag tctcgagccc       900
     ttggccttgg aagcgggcaa gcagctgcgt ggcctgaggg gaagggggcg gtggcatcga       960
     gaaactgtga gaaaacccag agcatcagaa aaagtgagcc caggctttgg ccattatctg      1020
     taagaaaaac aagaaaaggg gaacattata ctttcctggg tggctcaggg aaatgtgcag      1080
     atgcacagta ctccagacag cagctctgta cctgcctgct ctgtccctca gttctaacag      1140
     aatctagtca ctaagaacta acaggactac caatacgaac tgacaaatac taccactatg      1200
     acctgtgaca aagctgcata tttattaagt gggaagggaa cttttgatat tatttatcct      1260
     tgtaacagta tagatgatgg ttatttattc tatttataag gaattatgta tttttttttt      1320
     caataaagat ttatttatgt ggctaaaaaa aaaaaaaaa                             1359
//


spacer
spacer