spacer

EBI Dbfetch

ID   BC019930; SV 1; linear; mRNA; STD; MUS; 1579 BP.
XX
AC   BC019930;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   19-MAR-2009 (Rel. 100, Last updated, Version 10)
XX
DE   Mus musculus sigma non-opioid intracellular receptor 1, mRNA (cDNA clone
DE   MGC:29924 IMAGE:5123891), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1579
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1579
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; e4f66f165eb9632f6de4c439e4523ced.
DR   Ensembl-Gn; ENSMUSG00000036078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059354; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000071561; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 42 Row: p Column: 24
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 6754941.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1579
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:29924 IMAGE:5123891"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1579
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT   misc_difference 1..11
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /note="11 bases at the 5' end do not align to the mouse
FT                   genome."
FT   CDS             36..707
FT                   /codon_start=1
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /product="Sigmar1 protein"
FT                   /db_xref="GOA:O55242"
FT                   /db_xref="InterPro:IPR006716"
FT                   /db_xref="InterPro:IPR028545"
FT                   /db_xref="MGI:MGI:1195268"
FT                   /db_xref="UniProtKB/Swiss-Prot:O55242"
FT                   /protein_id="AAH19930.1"
FT                   /translation="MPWAAGRRWAWITLILTIIAVLIQAAWLWLGTQNFVFSREEIAQL
FT                   ARQYAGLDHELAFSRLIVELRRLHPGHVLPDEELQWVFVNAGGWMGAMCILHASLSEYV
FT                   LLFGTALGSHGHSGRYWAEISDTIISGTFHQWKEGTTKSEVFYPGETVVHGPGEATALE
FT                   WGPNTWMVEYGRGVIPSTLFFALADTFFSTQDYLTLFYTLRAYARGLRLELTTYLFGQD
FT                   S"
FT   misc_difference 1566..1579
FT                   /gene="Sigmar1"
FT                   /gene_synonym="mSigmaR1"
FT                   /note="polyA tail: 14 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1579 BP; 358 A; 449 C; 412 G; 360 T; 0 other;
     cccacgcgtc cggtggtgcc aggctgcccg ctagaatgcc gtgggccgcg ggacggcggt        60
     gggcatggat caccctgatt ctgactatta tcgcagtgct gatccaggcc gcctggttgt       120
     ggctgggcac tcaaaacttc gtcttctcta gagaagaaat agcgcagctt gctcgacagt       180
     atgcggggct ggaccatgag cttgccttct ctcggctgat cgtggagctg cggaggctgc       240
     acccaggcca cgtgctgccg gatgaggagc tgcagtgggt atttgtgaac gcgggcggct       300
     ggatgggcgc catgtgtatt ctgcacgcct cgctgtctga gtacgtgctg ctcttcggca       360
     ccgccctggg ctcccatggc cattcgggac gatactgggc tgagatttct gacaccatca       420
     tctctggcac cttccaccaa tggaaagagg gcaccacgaa aagtgaggtc ttctacccag       480
     gagagacagt tgtacacggg cctggagaag caacggctct ggagtgggga ccaaacacgt       540
     ggatggtgga gtacggccgg ggtgttattc cgtctaccct gttctttgca ctagccgaca       600
     ctttcttcag cacccaggac tacctcacac tcttctatac ccttcgggcc tatgcccggg       660
     gcctccggct tgagcttacc acctacctct ttggccaaga ctcctgacca gccaggcctg       720
     aaggaagatc tgtggatgga caggagcgcg gcaggaccac atccatctct ctactcgctg       780
     gaactcatat tcagacagca gcgtatacca tgcagatatt aagtacctgc tgtatgagga       840
     aggacataca tacttgtaca tccagacaca gctcttggga agcaaatgag acacagagat       900
     gctaagactt gtatgtactg taagatcatg cactcacatc cacccagaaa gggtcctcta       960
     catatactcc agggggccag tcatgtttga acacacatca caagcttgac tcactgactc      1020
     aggctttcct agagcctcct gctggcattc agggctctgg gatcaagggt tgaggtagat      1080
     gttacacact acctcactct gatgcctcat tcctgtagta atctctggtg aagggaaaga      1140
     ggagctgccc ttcggaggtc cccttcacct gcagctatga tgcccttccc ttcatccctt      1200
     tcctcaccat atgccttatc tccattccac tcccctgcta tgcaaatgcc cccctggctt      1260
     gtcctccctg cccccccccc ccggcaacca gttcagctgg gaaagcagag gcatgtagag      1320
     gatgctaaag ggaagggagg tcctccacta cggagaccct tgttggggtt agaatgggaa      1380
     agctggctag tgccccaggg ccagttccca aggagaggac ctggagaagt aagccggggt      1440
     ccaaggagcc accccattcc aaaagaagcc tttagtgtgt gtgtgcacac cctatcagtt      1500
     tccagacata tctgttgcaa tctctgtctt cttgtctctc tctgttaata aaaacatatt      1560
     aaacaaaaaa aaaaaaaaa                                                   1579
//


spacer
spacer