Dbfetch

ID   BC019741; SV 1; linear; mRNA; STD; MUS; 1343 BP.
XX
AC   BC019741;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 17)
XX
DE   Mus musculus regulator of G-protein signaling 11, mRNA (cDNA clone
DE   IMAGE:3666182), complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1343
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1343
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 4767c12bd133fb6560c4906008b8a802.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 40 Row: d Column: 20
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis
CC   This clone has the following problem: The cds is short compared to
CC   the longest cds in the locus.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1343
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="IMAGE:3666182"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1343
FT                   /gene="Rgs11"
FT   misc_difference 126
FT                   /gene="Rgs11"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   CDS             136..744
FT                   /codon_start=1
FT                   /gene="Rgs11"
FT                   /product="regulator of G-protein signaling 11"
FT                   /db_xref="GOA:Q9Z2H1"
FT                   /db_xref="InterPro:IPR000591"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR024066"
FT                   /db_xref="MGI:MGI:1354739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2H1"
FT                   /protein_id="AAH19741.1"
FT                   /translation="MSGCLPSNPWITDDVTYWAMNAPNVAAPTKLRVERWSFSFRELLD
FT                   DPVGRAHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLAPGAARWIN
FT                   IDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEEAVIPLET
FT                   KRWPFPFLRKPLHSSPSPALQSTPREPAATSSPEGANGE"
FT   misc_difference 483
FT                   /gene="Rgs11"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 733
FT                   /gene="Rgs11"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; amino acid
FT                   difference: 'N' in cDNA, 'D' in the mouse genome."
FT   misc_difference 1332..1343
FT                   /gene="Rgs11"
FT                   /note="polyA tail: 12 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1343 BP; 295 A; 420 C; 337 G; 291 T; 0 other;
     aggcgtgagt gagagacagc aagagtccct tcccaacccc tggtacagct tagtccccga        60
     gaccaccctg caccgccctc tggatccccc aggtacctga agttcagcag ccagcacggg       120
     ccgcacgatc ccatcatgtc agggtgtctg cccagcaacc cctggatcac agatgatgtc       180
     acctactggg ccatgaatgc gcccaacgtg gctgccccca caaaactccg cgttgagcga       240
     tggagcttca gcttccggga gctgctggat gaccccgtgg ggcgtgccca cttcatggac       300
     tttctccaga aggaattcag tgcggaaaac ctcagcttct gggaggcatg tgaggagctg       360
     cgctttggcg gacaggccca ggtccccacc ttggtggact ctgtgtatca gcagttcctg       420
     gcccctggag ctgcccgctg gatcaacatt gacagcagga cgatggagcg gaccctggag       480
     gggctgcgcc agccacaccg ctatgtcctg gatgcagcac agcttcacat ctacatgctc       540
     atgaagaagg actcctatcc aaggttcctg aagtctgaca tatacaaggg cctgctggag       600
     gaagctgtga ttccactgga gacaaagcgc tggccatttc cattcttgcg gaagcctctg       660
     cactcaagcc ccagccctgc tctccagtct acccccaggg agcctgcagc aaccagttcc       720
     cctgaaggtg ccaatgggga gtagtaggtg gctcttgctg catacctcac cttaccatca       780
     cctgcctgac accctgtggg gttgtgttct cctaacggag attccccagc actggcatca       840
     ctgtgtacac agtgaggtcc tttagtcttc agttcaggac taggctgtct caactctaga       900
     atgtcaagtc agtgacacat gaggaggtat cagtctctgg ccatgccacc ccatgcagga       960
     aggctcctcc actgtataat cctcctcagg ctaaacccag tggcttctta ggagacgatg      1020
     tctgcaggtg ccatgtcatt gccgtacgtg gcgtctcttc cacctgtcgt ctgatcagct      1080
     ctctagaaag gcgacagcac actgctgtcc tgactacagg gctcccagtt ctcatcgggc      1140
     aagtctttgt caagctggca gccctggcat ccagtcttcc tgtccaggtt gttcagtgcc      1200
     accagcattg ccacccccac cccagaggta gaaataaaga tggggcctcc tgccatgcag      1260
     ctcccaatag ggctgctctc tagtctccct tcacaaccca ttttcacaga aataaaactt      1320
     tcagtcccct gaaaaaaaaa aaa                                              1343
//