Dbfetch

ID   BC019589; SV 1; linear; mRNA; STD; MUS; 1319 BP.
XX
AC   BC019589;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus small nuclear ribonucleoprotein N, mRNA (cDNA clone MGC:30325
DE   IMAGE:3484323), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1319
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1319
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 8efff44b232087a94f0c21c9f66e489c.
DR   Ensembl-Gn; ENSMUSG00000102252; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032303; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032239; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032315; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032028; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032808; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031357; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031993; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032104; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032231; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032141; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032825; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031475; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000059305; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098402; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084268; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084217; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083814; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084737; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084328; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083754; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083796; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083958; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083841; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0085013; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083743; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082868; mus_musculus_wsbeij.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Lothar Hennighausen Ph.D., Robin Humphreys
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 40 Row: a Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 34328217.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1319
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="mix FVB/N, C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam5"
FT                   /clone="MGC:30325 IMAGE:3484323"
FT                   /tissue_type="Mammary tumor. WAP-TGF alpha model. 7 months
FT                   old, gross tissue."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1319
FT                   /gene="Snrpn"
FT                   /note="synonyms: Peg4, SMN, HCERN3, MGC18604, MGC30325"
FT   CDS             458..1180
FT                   /codon_start=1
FT                   /gene="Snrpn"
FT                   /product="small nuclear ribonucleoprotein N"
FT                   /db_xref="GOA:P63163"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR017131"
FT                   /db_xref="MGI:MGI:98347"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63163"
FT                   /protein_id="AAH19589.1"
FT                   /translation="MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDC
FT                   DEFRKIKPKNAKQPEREEKRVLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGP
FT                   GVGRAAGRGVPAGVPIPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAVAATASIAG
FT                   APTQYPPGRGTPPPPVGRATPPPGIMAPPPGMRPPMGPPIGLPPARGTPIGMPPPGMRP
FT                   PPPGIRGPPPPGMRPPRP"
FT   misc_difference 1307..1319
FT                   /gene="Snrpn"
FT                   /note="polyA tail: 13 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1319 BP; 351 A; 332 C; 335 G; 301 T; 0 other;
     ggagagggag ccggagatgc cagacgcttg gttctgagga gtgatttgca acgcaatgga        60
     gcgaggaagg gatcgcttac acttgagaag aactactgaa cagcacgtgc ccgaggtcga       120
     ggtccaggtc aaacgtcgaa ggacagcctc actgagcaac caagagtgtc acttgtaccc       180
     acgacgttct cagcaacagc aagttcctgt ggtggatttc caggcagaac taagacaggc       240
     attcttagct gagacaccaa gaggtggtta aagcagtatt gcaacttcaa ggtggtggaa       300
     ttcaaggaaa acaggaccca tcctctgtct gtgaaacttt ggtcaagctt acattgtttg       360
     ttaatagcct gcatcgaacc tttatttata tcccttcccc gagtattaag gatcttgaaa       420
     ttttagtgtt gacaacggct attgtggaac agcaatcatg actgtgggta agagtagcaa       480
     gatgctgcag cacattgact ataggatgag atgtatcctg caagatggga gaatcttcat       540
     tggcaccttc aaggcttttg acaagcatat gaatttgatc ctctgtgatt gtgatgagtt       600
     caggaagatc aagccaaaga atgcaaaaca gccagaacgt gaagaaaaac gggttttggg       660
     tctggtcttg ctacgtgggg agaacttggt ttcaatgact gtggagggcc cacctcctaa       720
     agatactggc attgctcgtg tgcctcttgc tggcgctgca ggtggccctg gggttggaag       780
     agcagctggc agaggagtgc cagcaggtgt acctattccc caggctcctg ctggattagc       840
     aggccctgtc agaggagttg gaggcccatc ccagcaggtc atgaccccac agggaagagg       900
     cactgttgca gctgctgctg ttgctgctac tgctagcatt gcaggagccc caacccagta       960
     cccgccagga cggggaactc cacctccacc tgtaggcaga gcaaccccac ctccaggcat      1020
     tatggctcct ccacctggta tgagaccacc catgggccca cccattgggc ttccccctgc      1080
     tcgtgggaca cctataggca tgcctcctcc aggaatgaga ccccctccac caggaattag      1140
     aggcccacct cccccaggaa tgcgcccacc aagaccctaa gatacagttg ataaatctca      1200
     gcccttctct tcccctacaa tgcttcttgt gaaattgtgt acctgcaagc tttttgaccc      1260
     ctcttactgc attaactata gataataaat acatagagca attcaaaaaa aaaaaaaaa       1319
//