spacer

EBI Dbfetch

ID   BC019447; SV 1; linear; mRNA; STD; MUS; 1672 BP.
XX
AC   BC019447;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus serine (or cysteine) peptidase inhibitor, clade C
DE   (antithrombin), member 1, mRNA (cDNA clone MGC:30300 IMAGE:5125534),
DE   complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1672
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-1672
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 242ef5c3c366ab0e4ab1b06ae9e528a8.
DR   Ensembl-Gn; ENSMUSG00000026715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064725; mus_musculus.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Jeffrey E. Green, M.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 41 Row: n Column: 23
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: Hexamer frequency ORF
CC   analysis, Similarity but not identity to protein.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1672
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Li9"
FT                   /clone="MGC:30300 IMAGE:5125534"
FT                   /tissue_type="Liver, normal. 5 month old male mouse."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..1672
FT                   /gene="Serpinc1"
FT                   /note="synonym: ATIII"
FT   CDS             173..1570
FT                   /codon_start=1
FT                   /gene="Serpinc1"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade C
FT                   (antithrombin), member 1"
FT                   /db_xref="GOA:P32261"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR015555"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:88095"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32261"
FT                   /protein_id="AAH19447.1"
FT                   /translation="MYSPGAGSGAAGERKLCLLSLLLIGALGCAICHGNPVDDICIAKP
FT                   RDIPVNPLCIYRSPGKKATEEDGSEQKVPEATNRRVWELSKANSRFATNFYQHLADSKN
FT                   DNDNIFLSPLSISTAFAMTKLGACNDTLKQLMEVFKFDTISEKTSDQIHFFFAKLNCRL
FT                   YRKANKSSDLVSANRLFGDKSLTFNESYQDVSEVVYGAKLQPLDFKENPEQSRVTINNW
FT                   VANKTEGRIKDVIPQGAINELTALVLVNTIYFKGLWKSKFSPENTRKEPFYKVDGQSCP
FT                   VPMMYQEGKFKYRRVAEGTQVLELPFKGDDITMVLILPKPEKSLAKVEQELTPELLQEW
FT                   LDELSETMLVVHMPRFRTEDGFSLKEQLQDMGLIDLFSPEKSQLPGIVAGGRDDLYVSD
FT                   AFHKAFLEVNEEGSEAAASTSVVITGRSLNPNRVTFKANRPFLVLIREVALNTIIFMGR
FT                   VANPCVN"
FT   misc_difference 1651..1672
FT                   /gene="Serpinc1"
FT                   /note="polyA tail: 22 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 1672 BP; 444 A; 437 C; 414 G; 377 T; 0 other;
     attttagtga agtggtgaga tataagacat aatcagaaga catatctacc tgaagacttt        60
     aaggggagag ctccctcccc cacctggcct ctggacctct cagatttagg ggaaagaacc       120
     agttttcgga gtgatcgtct cagtcagcac catctctgta ggagcatcgg ccatgtattc       180
     ccctggggca ggaagtgggg ctgctggtga gaggaagctt tgtctcctct ctctgctcct       240
     catcggtgcc ttgggctgtg ctatctgtca cggaaaccct gtggacgaca tctgcatagc       300
     gaagccccga gacatccccg tgaatccctt gtgcatttac cgctcccctg ggaagaaggc       360
     caccgaggag gatggctcag agcagaaggt tccagaagcc accaaccggc gggtctggga       420
     actgtccaag gccaattcgc gatttgccac taacttctac cagcacctgg cagactccaa       480
     gaatgacaac gacaacattt tcctgtcacc cttgagcatc tccactgctt ttgctatgac       540
     caagctgggt gcctgtaacg acactctcaa gcagctgatg gaggttttta aatttgatac       600
     catctccgag aagacatccg accagatcca cttcttcttt gccaaactga actgccgact       660
     ctatcgaaaa gccaacaagt cctctgactt ggtatcagcc aaccgccttt ttggagacaa       720
     atccctcacc ttcaacgaga gctatcaaga tgttagtgag gttgtctatg gagccaagct       780
     ccagcccctg gacttcaagg agaatccgga gcaatccaga gtgaccatca acaactgggt       840
     agctaataag actgaaggcc gcatcaaaga tgtcatccca cagggcgcca ttaacgagct       900
     cactgccctg gttctggtta acaccattta cttcaagggc ctgtggaagt caaagttcag       960
     ccctgagaac acaaggaagg aaccgttcta taaggtcgat gggcagtcat gcccagtgcc      1020
     tatgatgtac caggaaggca aattcaaata ccggcgcgtg gcagagggca cccaggtgct      1080
     agagctgccc ttcaaggggg atgacatcac catggtgctc atcctgccca agcctgagaa      1140
     gagcctggcc aaggtggagc aggagctcac cccagagctg ctgcaggagt ggctggatga      1200
     gctgtcagag actatgcttg tggtccacat gccccgcttc cgcaccgagg atggcttcag      1260
     tctgaaggag cagctgcaag acatgggcct cattgatctc ttcagccctg aaaagtccca      1320
     actcccaggg atcgttgctg gaggcaggga cgacctctat gtctccgacg cattccacaa      1380
     agcatttctt gaggtaaatg aggaaggcag tgaagcagca gcgagtactt ctgtcgtgat      1440
     tactggccgg tcactgaacc ccaatagggt gaccttcaag gccaacaggc ccttcctggt      1500
     tcttataagg gaagttgcac tgaacactat tatattcatg gggagagtgg ctaatccttg      1560
     tgtgaactaa aatattctta atctttgcac cttttcctac tttggtgttt gtgaatagaa      1620
     gtaaaaataa atacgactgc cacctcacga aaaaaaaaaa aaaaaaaaaa aa              1672
//


spacer
spacer