Dbfetch

ID   BC019379; SV 1; linear; mRNA; STD; MUS; 2242 BP.
XX
AC   BC019379;
XX
DT   04-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 14)
XX
DE   Mus musculus G protein-coupled receptor kinase 5, mRNA (cDNA clone
DE   MGC:30358 IMAGE:5116510), complete cds.
XX
KW   MGC.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2242
RX   DOI; 10.1073/pnas.242603899.
RX   PUBMED; 12477932.
RG   Mammalian Gene Collection Program Team
RA   Strausberg R.L., Feingold E.A., Grouse L.H., Derge J.G., Klausner R.D.,
RA   Collins F.S., Wagner L., Shenmen C.M., Schuler G.D., Altschul S.F.,
RA   Zeeberg B., Buetow K.H., Schaefer C.F., Bhat N.K., Hopkins R.F., Jordan H.,
RA   Moore T., Max S.I., Wang J., Hsieh F., Diatchenko L., Marusina K.,
RA   Farmer A.A., Rubin G.M., Hong L., Stapleton M., Soares M.B., Bonaldo M.F.,
RA   Casavant T.L., Scheetz T.E., Brownstein M.J., Usdin T.B., Toshiyuki S.,
RA   Carninci P., Prange C., Raha S.S., Loquellano N.A., Peters G.J.,
RA   Abramson R.D., Mullahy S.J., Bosak S.A., McEwan P.J., McKernan K.J.,
RA   Malek J.A., Gunaratne P.H., Richards S., Worley K.C., Hale S., Garcia A.M.,
RA   Gay L.J., Hulyk S.W., Villalon D.K., Muzny D.M., Sodergren E.J., Lu X.,
RA   Gibbs R.A., Fahey J., Helton E., Ketteman M., Madan A., Rodrigues S.,
RA   Sanchez A., Whiting M., Madan A., Young A.C., Shevchenko Y., Bouffard G.G.,
RA   Blakesley R.W., Touchman J.W., Green E.D., Dickson M.C., Rodriguez A.C.,
RA   Grimwood J., Schmutz J., Myers R.M., Butterfield Y.S., Krzywinski M.I.,
RA   Skalska U., Smailus D.E., Schnerch A., Schein J.E., Jones S.J., Marra M.A.;
RT   "Generation and initial analysis of more than 15,000 full-length human and
RT   mouse cDNA sequences";
RL   Proc. Natl. Acad. Sci. U.S.A. 99(26):16899-16903(2002).
XX
RN   [2]
RC   NIH-MGC Project URL: http://mgc.nci.nih.gov
RP   1-2242
RG   NIH MGC Project
RA   ;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   National Institutes of Health, Mammalian Gene Collection (MGC), Bethesda,
RL   MD 20892-2590, USA
XX
DR   MD5; 824beed3791c38dc4008dda29abfbc02.
DR   Ensembl-Gn; ENSMUSG00000003228; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0025299; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0025275; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0025244; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0025030; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025713; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0024495; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0025010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0025142; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0025103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0025228; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0025136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0025771; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0024243; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0024565; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000003313; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0052292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0052299; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0052248; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0052245; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0051978; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0052730; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0052132; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0051924; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0052028; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0051986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0052146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0051980; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0052864; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0051737; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0051259; mus_musculus_wsbeij.
DR   EuropePMC; PMC2682897; 19329434.
XX
CC   Contact: MGC help desk
CC   Email: cgapbs-r@mail.nih.gov
CC   Tissue Procurement: Gilbert Smith, Ph.D.
CC   cDNA Library Preparation: Life Technologies, Inc.
CC   cDNA Library Arrayed by: The I.M.A.G.E. Consortium (LLNL)
CC   DNA Sequencing by: Baylor College of Medicine Human Genome
CC   Sequencing Center
CC   Center code: BCM-HGSC
CC   Web site: http://www.hgsc.bcm.tmc.edu/cdna/
CC   Contact: amg@bcm.tmc.edu
CC   Gunaratne, P.H., Garcia, A.M., Lu, X., Hulyk, S.W., Loulseged, H.,
CC   Kowis, C.R., Sneed, A.J., Martin, R.G., Muzny, D.M., Nanavati,
CC   A.N., Gibbs, R.A.
CC   Clone distribution: MGC clone distribution information can be found
CC   through the I.M.A.G.E. Consortium/LLNL at: http://image.llnl.gov
CC   Series: IRAK Plate: 41 Row: m Column: 8
CC   This clone was selected for full length sequencing because it
CC   passed the following selection criteria: matched mRNA gi: 31980924.
CC   Differences found between this sequence and the mouse C57BL/6J
CC   genome (build 36) are described in misc_difference features below.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2242
FT                   /organism="Mus musculus"
FT                   /lab_host="DH10B"
FT                   /strain="FVB/N-3"
FT                   /mol_type="mRNA"
FT                   /clone_lib="NCI_CGAP_Mam2"
FT                   /clone="MGC:30358 IMAGE:5116510"
FT                   /tissue_type="Mammary tumor. MMTV-LTR/INT3 model. 5 month
FT                   old mouse. Taken by biopsy."
FT                   /note="Vector: pCMV-SPORT6"
FT                   /db_xref="taxon:10090"
FT   gene            1..2242
FT                   /gene="Gprk5"
FT                   /note="synonym: GRK5"
FT   misc_difference 31
FT                   /gene="Gprk5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome."
FT   misc_difference 51
FT                   /gene="Gprk5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   CDS             105..1877
FT                   /codon_start=1
FT                   /gene="Gprk5"
FT                   /product="G protein-coupled receptor kinase 5"
FT                   /db_xref="GOA:Q8VEB1"
FT                   /db_xref="InterPro:IPR000239"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016137"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:109161"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VEB1"
FT                   /protein_id="AAH19379.1"
FT                   /translation="MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHISQCEDL
FT                   RRTIDRDYYSLCDKQPIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKE
FT                   IMTKYLTPKSPVFIAQVGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLTGDPFHEYLD
FT                   SMYFDRFLQWKWLERQPVTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRI
FT                   KKRKGESMALNEKQILEKVNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNP
FT                   GFEEERALFYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGD
FT                   LIRGRVGTVGYMAPEVLNNQRYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDR
FT                   RVLETEEVYSSKFSEEAKSICNMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEA
FT                   GMLDPPFVPDPRAVYCKDVLDIEQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIE
FT                   TECFKELNVFGPNGTLSPDLNRSQPPEPPKKGLFHRLFRRQHQSNSKSSPTPKTSCNHR
FT                   INSNHINSNSTGSS"
FT   misc_difference 272
FT                   /gene="Gprk5"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 565
FT                   /gene="Gprk5"
FT                   /note="'C' in cDNA is 'A' in the mouse genome; amino acid
FT                   difference: 'T' in cDNA, 'K' in the mouse genome."
FT   misc_difference 1325
FT                   /gene="Gprk5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1418
FT                   /gene="Gprk5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1442
FT                   /gene="Gprk5"
FT                   /note="'C' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1775
FT                   /gene="Gprk5"
FT                   /note="'G' in cDNA is 'T' in the mouse genome; no amino
FT                   acid change."
FT   misc_difference 1941
FT                   /gene="Gprk5"
FT                   /note="'T' in cDNA is 'C' in the mouse genome."
FT   misc_difference 1944
FT                   /gene="Gprk5"
FT                   /note="'A' in cDNA is 'G' in the mouse genome."
FT   misc_difference 2228..2242
FT                   /gene="Gprk5"
FT                   /note="polyA tail: 15 bases do not align to the mouse
FT                   genome."
XX
SQ   Sequence 2242 BP; 634 A; 536 C; 579 G; 493 T; 0 other;
     gtttggcagc agcggcggca gctcgagcag cggcagcggc agcggcatca tcccagacgc        60
     tgacagcaca gccggccggc tccctcgctg actgccgact gtcaatggag ctggaaaaca       120
     tcgtggccaa cacggtcttg ctgaaagccc gggaaggggg tggaggaaag cgcaaaggga       180
     aaagcaagaa gtggaaggaa atcctgaagt ttcctcacat cagccagtgt gaagacctcc       240
     gaaggaccat agacagagat tactacagtc tctgtgacaa gcaaccaatt gggagactgc       300
     tttttcgaca gttctgtgaa accaggcctg ggctggagtg ctacattcag ttcctggact       360
     tagtggcaga atatgaaatt actccagatg aaaaccttgg ggcgaagggg aaggaaataa       420
     tgaccaagta cctcactcca aagtccccag tcttcattgc ccaagttgga caggacctgg       480
     tctcccagac agagaagaag ctcctgcaga gcccctgcaa agaactcttc tctgcttgtg       540
     ctcagtctgt ccatgactac ttgacgggag accccttcca cgagtacctg gatagcatgt       600
     attttgaccg ttttctgcag tggaaatggt tagaaagaca accagtgacc aaaaacactt       660
     tccggcagta ccgagtgctg ggcaaagggg gctttggaga ggtctgtgcc tgccaggttc       720
     gggccactgg taaaatgtat gcttgtaaac gcttagagaa gaagaggatc aaaaagagga       780
     aaggcgaatc catggcactc aacgaaaagc agattcttga gaaggtcaac agccagtttg       840
     tggtcaacct ggcctatgcc tatgaaacca aagatgcact atgcctggtt ctgaccatta       900
     tgaatggtgg tgacctgaag tttcacatct acaatatggg gaatcctggc tttgaggaag       960
     agcgagcctt attttatgca gctgagatcc tctgtggcct agaagactta caccgtgaga      1020
     acactgtcta tagagatcta aaacccgaaa acatcttgct ggatgattat ggccacataa      1080
     ggatctcaga cctcggactg gccgtgaaga tccccgaggg agaccttatc cgtggccggg      1140
     taggcactgt tggctacatg gccccagaag ttctgaacaa ccagcgatat ggactgagcc      1200
     ctgactactg gggcctgggc tgcctcatct atgagatgat tgaaggccag tcaccatttc      1260
     gaggtcgcaa ggagaaggtt aagcgggaag aggtggatcg ccgggtgctg gagactgagg      1320
     aagtatattc ctccaagttc tctgaagagg ccaagtccat ctgcaacatg ctgctcacca      1380
     aagactcgaa gcagaggctg ggctgccagg aggagggagc cgccgaggtc aagaggcacc      1440
     ccttcttcag gaacatgaac tttaagcgcc tggaggctgg gatgttggac cctcccttcg      1500
     ttccagatcc ccgggctgta tactgcaagg atgtgctgga cattgagcag ttctccactg      1560
     tgaaaggtgt caacctggac catacggacg atgattttta ctcaaagttc tctacaggct      1620
     ctgtgccaat tccatggcaa aatgagatga tagaaacaga atgtttcaag gagctgaatg      1680
     tgttcggacc taacggtacc ctctcaccag acctgaacag aagtcagcct ccagaaccgc      1740
     caaagaaagg gctgttccac agactcttca ggcggcagca tcaaagcaat tccaagagtt      1800
     cacctactcc taagaccagt tgtaaccacc gaataaattc aaaccacatc aattcaaact      1860
     ccactggaag cagctagttt cggctctggc cttgaagtca aaagtggaac cagctcagag      1920
     ccttctactt ggaagcagaa tttatagcca ggggagcttc cactgtggct cagtggccag      1980
     caaagctcca gtgggaacta agataggaga ccgttccccc aataacaaac ctccaagttt      2040
     ctcaaagaaa tttccactca ggtctgtttt ccaaggtggc cccaagctgg ggtggactag      2100
     aattttcctt gttgaacatt gcaatagaaa cccaatggga tatgacagct tgcacggatt      2160
     ttaatagcat cctaactaga actgaatttt gtctttatta tttttaaagg aaagttttgt      2220
     aaatttcaaa aaaaaaaaaa aa                                               2242
//